PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna11668.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family HB-other
Protein Properties Length: 403aa    MW: 44775.3 Da    PI: 4.7978
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna11668.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox22.12.6e-07336382753
                              --HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS
                 Homeobox   7 ftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRa 53 
                              ++k  l++Le+++++++ p+ +    + + ++L+ +++  WF  +R 
  mrna11668.1-v1.0-hybrid 336 LKKVHLDTLERVYRRTKRPTNAIVSSIVHVTNLPRKRIVKWFEDKRS 382
                              6677899*************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.167327387IPR001356Homeobox domain
CDDcd000863.81E-5333381No hitNo description
SMARTSM003890.001333391IPR001356Homeobox domain
SuperFamilySSF466893.38E-7334386IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.0E-7335384IPR009057Homeodomain-like
PfamPF000468.8E-5336382IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0002229Biological Processdefense response to oomycetes
GO:0009414Biological Processresponse to water deprivation
GO:0009682Biological Processinduced systemic resistance
GO:0009787Biological Processregulation of abscisic acid-activated signaling pathway
GO:0010118Biological Processstomatal movement
GO:0050832Biological Processdefense response to fungus
GO:2000022Biological Processregulation of jasmonic acid mediated signaling pathway
GO:2000071Biological Processregulation of defense response by callose deposition
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 403 aa     Download sequence    Send to blast
MLLIVLTQLL DKCREPQQSN DTRAKSKSVD KPRTTEKGAA EAVTFKTPPF RSRLMAFASA  60
LNTPNGLRRL PSSRHEITRT GPAALVLPRH LPARFPSTLA LARRKNHRGS ALTSSPPKIK  120
KKSAARNAEE EDEVDGDAID ALFSLLEEDL RNDGVSLDDD GEDDEISEED LARLEEELAE  180
AFGAIDEDED EDDDGDDDVI QSNATEEEEE EDEDDEVEVA VKLKTWQFRR LASALKVGRR  240
KTSIKNLAAE LCLDRALVLQ MLRDPPPNLL MLSAALPDAP APKKSVPVPE PEPEETIVEA  300
TVDTVVETDS DAAVVEAAVK VPVHVRQQKF SAQKRLKKVH LDTLERVYRR TKRPTNAIVS  360
SIVHVTNLPR KRIVKWFEDK RSEEGVPDSR RPYQPSAPTT VN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004291470.10.0PREDICTED: retrotransposon-like protein 1
SwissprotQ8H0V52e-71OCP3_ARATH; Protein OVEREXPRESSOR OF CATIONIC PEROXIDASE 3
TrEMBLF6H3091e-100F6H309_VITVI; Putative uncharacterized protein
STRINGVIT_04s0008g05190.t011e-99(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101813138
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11270.14e-56overexpressor of cationic peroxidase 3