PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna11666.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family bZIP
Protein Properties Length: 167aa    MW: 18034.9 Da    PI: 10.277
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna11666.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_149.49.6e-1686146161
                              XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61 
                              +ke+kr +r+ +NR++A+  R+RKka++  Le +vk Le++N++L ++l++l++e + l+ 
  mrna11666.1-v1.0-hybrid  86 DKESKRLKRLLRNRVSAQQARERKKAYLSDLEVRVKDLEQKNSELDERLSTLQNENQMLRH 146
                              689*****************************************************98865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PRINTSPR000414.3E-61227IPR001630cAMP response element binding (CREB) protein
PRINTSPR000414.3E-685101IPR001630cAMP response element binding (CREB) protein
SMARTSM003382.0E-1486150IPR004827Basic-leucine zipper domain
PfamPF001701.9E-1487147IPR004827Basic-leucine zipper domain
PROSITE profilePS5021712.41588151IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.06E-1390148No hitNo description
Gene3DG3DSA:1.20.5.1708.9E-1790150No hitNo description
CDDcd147042.89E-1691142No hitNo description
PROSITE patternPS00036093108IPR004827Basic-leucine zipper domain
PRINTSPR000414.3E-6103123IPR001630cAMP response element binding (CREB) protein
PRINTSPR000414.3E-6123140IPR001630cAMP response element binding (CREB) protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009737Biological Processresponse to abscisic acid
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0010017Biological Processred or far-red light signaling pathway
GO:0010099Biological Processregulation of photomorphogenesis
GO:0010114Biological Processresponse to red light
GO:0010218Biological Processresponse to far red light
GO:0010224Biological Processresponse to UV-B
GO:0031539Biological Processpositive regulation of anthocyanin metabolic process
GO:0042753Biological Processpositive regulation of circadian rhythm
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0003690Molecular Functiondouble-stranded DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009001anatomyfruit
PO:0007010developmental stagewhole plant fruit ripening stage
PO:0007027developmental stagewhole plant fruit formation stage 70% to final size
Sequence ? help Back to Top
Protein Sequence    Length: 167 aa     Download sequence    Send to blast
MLQDQATSSL AASSLPSSSE RSSSSAFQLE VKEGLESDEE IRRVPEIGGE SAGASVSGRE  60
AGSLAGPDRV QVAGESQRKR GRSPADKESK RLKRLLRNRV SAQQARERKK AYLSDLEVRV  120
KDLEQKNSEL DERLSTLQNE NQMLRHILKN TTASRRGGGG ANAEGS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2oqq_A1e-17111150342Transcription factor HY5
2oqq_B1e-17111150342Transcription factor HY5
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00117ampDAPTransfer from AT5G11260Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP9847910.0KP984791.1 Fragaria x ananassa cultivar Toyonaka transcription factor HY5 (HY5) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004291469.11e-112PREDICTED: transcription factor HY5
SwissprotO246462e-69HY5_ARATH; Transcription factor HY5
TrEMBLA0A0F7GQF57e-96A0A0F7GQF5_FRAAN; Transcription factor HY5
STRINGPOPTR_0006s26800.16e-79(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF70643248
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11260.15e-68bZIP family protein