PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna11233.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family M-type_MADS
Protein Properties Length: 315aa    MW: 36345.2 Da    PI: 6.7969
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna11233.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF60.51.9e-191354344
                             --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
                   SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                             i +++ r +tf kR++gilKKA+E S+LC+++ ++ii+++++
  mrna11233.1-v1.0-hybrid 13 IADERSRRITFQKRKKGILKKAYEFSTLCGVDMCLIIYGPKQ 54
                             789999**********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.1E-15162IPR002100Transcription factor, MADS-box
PROSITE profilePS5006617.787353IPR002100Transcription factor, MADS-box
CDDcd002665.70E-24484No hitNo description
PRINTSPR004041.5E-10525IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.83E-19586IPR002100Transcription factor, MADS-box
PfamPF003191.1E-181354IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-102540IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-104061IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MGRGGGKLNM QLIADERSRR ITFQKRKKGI LKKAYEFSTL CGVDMCLIIY GPKQSDRRPA  60
ELHTWPQNPD EVNRIIEKFK LNNKPATKTY NLSDWLHEQK GKMDAKVSKL KSDMYEAKYP  120
TWDDRINEFS EEQLEELVNV LDQKIEYGKR TLNNVRAPRT LQLGGNDVGD VTSQKLSNHM  180
HNYAHYLGEY EDHKPSYVGM MDMQMPFSID QPTNYSQIFQ YDSDLNSMMA NPLMGYPRTY  240
YDPSEENQMV QSPAEKMMMF NSVPGSSMSH YAQLIHKPMS YTQYPMNISS ISSQLGTPQV  300
KDCEDDNLVH DKMV*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11627RSRRITFQKRKK
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna11233.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011458807.10.0PREDICTED: agamous-like MADS-box protein AGL19
RefseqXP_011458808.10.0PREDICTED: agamous-like MADS-box protein AGL19
TrEMBLA0A2P6PXE40.0A0A2P6PXE4_ROSCH; Putative transcription factor MADS-type1 family
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53431111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55690.17e-23M-type_MADS family protein