PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna10484.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family G2-like
Protein Properties Length: 594aa    MW: 65831.9 Da    PI: 5.8984
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna10484.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like871.8e-27323377156
                  G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                              k +++WtpeLH++Fv+aveqL G ++A+P++ilelmk +gLt+++v+SHLQkYR++
  mrna10484.1-v1.0-hybrid 323 KMKVDWTPELHKKFVHAVEQL-GVDQAIPSRILELMKAEGLTRHNVASHLQKYRMH 377
                              5689*****************.********************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521721.35E-647146IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23005.7E-647120No hitNo description
Gene3DG3DSA:3.40.50.23005.7E-6178187No hitNo description
PROSITE profilePS5129414.406320379IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.3E-26321379IPR009057Homeodomain-like
SuperFamilySSF466891.16E-17322380IPR009057Homeodomain-like
TIGRFAMsTIGR015576.6E-24323378IPR006447Myb domain, plants
PfamPF002492.2E-8326375IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 594 aa     Download sequence    Send to blast
MESTAANLID DIHRLQQQAD SDGLRNDATS AMVCTASDLE GWKDFPKGLR VLLLDEDTGY  60
SAEIRSKLEA MDYIVTTFRN ETEALSAFSN NPESFHVAII EVNTSKGDWG FKFLDTAKDM  120
PIIIEFLRKP LCEEKLRNIW QHVVHKAFNA GGKAVSESIK SIKESVLPTL QPKLENEPPK  180
CKISVVTENA ARVPEHDHEQ STGNDKYPAP STPQIKQGSR LLDDGDCQEQ TNSSEKESGE  240
HDGESKSVET TCGNADDTLQ ISEPQMPEKI VVKQENDSAD ASKLENNLSQ PHIRDCTNDT  300
GCATENLSKA SGLNHSYKSS RKKMKVDWTP ELHKKFVHAV EQLGVDQAIP SRILELMKAE  360
GLTRHNVASH LQKYRMHKRH ILPKDEDRRL LHPTDPTQMS YYSHKPIMAF PPYHYNSAVS  420
MPGVYPMWGQ PASHPANIQM WGQPSYPPWQ ASENWHWKPS YQALHADAWG CPVMPQPLQG  480
GYSSYPQTAS GVHNPNVVDN GCSLPHNSSE LHPIASVVIN ANVADNGCSM AHDSSELNLA  540
EEIIDKVMKE AISKPWLPLP LGLKLPSTEG VLAELSRQGI CNIPPPIDGS NSR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5lxu_A3e-16328377655Transcription factor LUX
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna10484.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004300274.10.0PREDICTED: two-component response regulator-like APRR2 isoform X1
RefseqXP_011465179.10.0PREDICTED: two-component response regulator-like APRR2 isoform X1
RefseqXP_011465180.10.0PREDICTED: two-component response regulator-like APRR2 isoform X1
RefseqXP_011465181.10.0PREDICTED: two-component response regulator-like APRR2 isoform X1
RefseqXP_011465182.10.0PREDICTED: two-component response regulator-like APRR2 isoform X1
TrEMBLA0A2P6P9P60.0A0A2P6P9P6_ROSCH; Putative response regulator and transcription factor RR-A-type family
STRINGXP_004300274.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35663465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18020.61e-132ARR-B family protein