PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna10041.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family ARR-B
Protein Properties Length: 677aa    MW: 74874.4 Da    PI: 6.0798
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna10041.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like87.41.3e-27202255155
                  G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                              kpr++W+ +LH++Fv av+qL G ekA+Pk+il+lm+v+gL++e+v+SHLQkYR 
  mrna10041.1-v1.0-hybrid 202 KPRVVWSGDLHRKFVAAVNQL-GVEKAVPKKILDLMDVEGLSRENVASHLQKYRQ 255
                              79*******************.********************************6 PP

2Response_reg77.83.8e-26161241109
                              EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHH CS
             Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeee 84 
                              vl vdD+p+ ++ l+ +l+k +y +v+++ ++ +ale+l+e++  +Dl++ D++mp+mdG++ll+ +  e  +lp+i+++++++ e
  mrna10041.1-v1.0-hybrid  16 VLAVDDDPTCLKFLEGLLRKCKY-HVTTTNQAIKALEMLRENRnkYDLVISDVNMPDMDGFKLLELLGLEM-DLPVIMLSGYSDVE 99 
                              799********************.***************999889*********************96644.8************* PP

                              HHHHHHHTTESEEEESS--HHHHHH CS
             Response_reg  85 dalealkaGakdflsKpfdpeelvk 109
                              ++ + ++ Ga d+  Kp+  eel +
  mrna10041.1-v1.0-hybrid 100 LVMKGIDHGACDYMLKPVRLEELKN 124
                              **********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363921.2E-1531676IPR017053Response regulator B-type, plant
SuperFamilySSF521723.13E-3712137IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23002.3E-4312153No hitNo description
SMARTSM004482.5E-3314126IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011043.72815130IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.1E-2316124IPR001789Signal transduction response regulator, receiver domain
CDDcd001563.27E-2817129No hitNo description
PROSITE profilePS5129411.368199258IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.1E-28199259IPR009057Homeodomain-like
SuperFamilySSF466892.33E-18200259IPR009057Homeodomain-like
TIGRFAMsTIGR015572.2E-23202255IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
PO:0007134developmental stagesporophyte vegetative stage
Sequence ? help Back to Top
Protein Sequence    Length: 677 aa     Download sequence    Send to blast
MTVEDQRDRF PEGMRVLAVD DDPTCLKFLE GLLRKCKYHV TTTNQAIKAL EMLRENRNKY  60
DLVISDVNMP DMDGFKLLEL LGLEMDLPVI MLSGYSDVEL VMKGIDHGAC DYMLKPVRLE  120
ELKNIWQHVV RKKKSETKDQ KKSSNQDKAS NGTGEGVRGA SPTGSSDQNW KLHKKRKDQN  180
RDEEEESEDD EHETEDSLNQ KKPRVVWSGD LHRKFVAAVN QLGVEKAVPK KILDLMDVEG  240
LSRENVASHL QKYRQYLKKL RGKESPYARM GLLDGFRDIQ SLRSGRMSSS TLSTYTSGGL  300
LRRLNSSAGL STGGMTSAGL GQPGHSQNLS SYINPFAELQ PTVPPNQSPH LFQGTPALSK  360
FNPLQQSKCI NHNGKSYPDN DSANYRLSST FQDSGVSSSS LPSDSNFASN PLVLQGIPQQ  420
TNSMGVFGNP TSVKVSFGIS GSSNFLDYNR CSENIQGGAQ SSSFSSNALP MSERFNRGQI  480
HTNNLGVCSS RPQIGNTLND FSSVSALSAP VDELRGNVEN QEGLIGDVVP TLTYMPKQRW  540
EEHKTGYIHD SNQTFSAITS PGSTLGTDGI VSHKLNQNDA VCNYERNSSL HDQLNGATPI  600
FVQPSEAGKS SMETKMKPNE DYFLEQTHSP NGFLQNSYES FDDIMSTIMR REQNENVDTL  660
LDAEFGFDAH SLGSCM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-23200260363ARR10-B
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna10041.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011460283.10.0PREDICTED: two-component response regulator ARR12
RefseqXP_011460333.10.0PREDICTED: two-component response regulator ARR12
TrEMBLA0A2P6RIC30.0A0A2P6RIC3_ROSCH; Two-component response regulator
STRINGXP_004287107.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.12e-90response regulator 12