PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna09389.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family WOX
Protein Properties Length: 386aa    MW: 44248.4 Da    PI: 7.93
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna09389.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox69.54.1e-2286145357
                              --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
                 Homeobox   3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                              +R+++t+eql++Leel+++ +r+psae++++++++l    +++ ++V++WFqN++a+e++
  mrna09389.1-v1.0-hybrid  86 SRWNPTPEQLRALEELYRRgTRTPSAEQIQQITAQLrrfgKIEGKNVFYWFQNHKARERQ 145
                              7*****************99**************************************97 PP

2Wus_type_Homeobox114.55.1e-3785147365
        Wus_type_Homeobox   3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                              ++RW+PtpeQ++ Leely++G+rtP++e+iq+ita+L+++Gkie+kNVfyWFQN+kaRerqk+
  mrna09389.1-v1.0-hybrid  85 SSRWNPTPEQLRALEELYRRGTRTPSAEQIQQITAQLRRFGKIEGKNVFYWFQNHKARERQKR 147
                              79***********************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003899.5E-583150IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.1E-986145IPR009057Homeodomain-like
SuperFamilySSF466891.66E-1286152IPR009057Homeodomain-like
PfamPF000467.8E-2086145IPR001356Homeobox domain
CDDcd000861.43E-687147No hitNo description
PROSITE profilePS5007111.45191146IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048513Biological Processanimal organ development
GO:0099402Biological Processplant organ development
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 386 aa     Download sequence    Send to blast
MWMMGYNDSS DFNMIPDSAF NGRKIRPLVP RTHNNNNNNN SSTSTHVPPC FSRIHAASDF  60
LAQYHQLGEQ RGMREFNTVP QVVVSSRWNP TPEQLRALEE LYRRGTRTPS AEQIQQITAQ  120
LRRFGKIEGK NVFYWFQNHK ARERQKRRRQ MESHDDLQLM CSADHQKKES LGGASRTVYE  180
VEETKNWAPS TNCMTTSLQD HLHHHQQETV KAGAEENRTE GWVQFDEEEL QQLQQQQRRN  240
SMPVEKNATW QMMQLSCPPP PPSVPSLHDL THLINAPTCP RATVRTMGMD QKQLINNPNN  300
KTSPPHDLSI FIAPCRSGAA LNGRHLLHHH HSVEDEDQTQ TLELFPLRSN TCGEKSHLAA  360
EKSSLNPSFG TGPNYQFFEF LPLKN*
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna09389.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011464491.10.0PREDICTED: WUSCHEL-related homeobox 1
TrEMBLA0A2P6P1V70.0A0A2P6P1V7_ROSCH; Putative transcription factor Homobox-WOX family
STRINGXP_004301251.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF28923471
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18010.12e-57WUSCHEL related homeobox 1