PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna09331.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family G2-like
Protein Properties Length: 472aa    MW: 51762 Da    PI: 7.1526
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna09331.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.55.3e-32281334255
                  G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                              pr+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  mrna09331.1-v1.0-hybrid 281 PRMRWTSSLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 334
                              9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.69E-15278335IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-28279335IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-23281334IPR006447Myb domain, plants
PfamPF002497.2E-7282333IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009887Biological Processorgan morphogenesis
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009956Biological Processradial pattern formation
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010158Biological Processabaxial cell fate specification
GO:0010229Biological Processinflorescence development
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 472 aa     Download sequence    Send to blast
MPHKGILESL NPIPDLSLHI SLPNSASNEP ADSAAFNIWR CRDNNTDVHD GVGGLVNSHG  60
DDATTPPPPL AADTELSLAN PTSASESDNN NNSWKMMNSS YFSRDQQQAE KHSNISHGLS  120
MLDVAELGMK PIKGIPVYNT TPAPANCSFP FSQPNLDPSR DISAAANNPK LCYYQTPPYL  180
SPAVPFRPGG AAMGGFESTR FNGITMESLR VPQHQLQYLN HHHHHQQQQQ LQHQHQCGVG  240
VGIGAHHHHH HHGDFSSNNG FIMRSRFTPK SYQSKRNMRA PRMRWTSSLH ARFVHAVELL  300
GGHERATPKS VLELMDVKDL TLAHVKSHLQ MYRTVKNTDK PVASSDGSGD EDLLSTTTTT  360
HHQNSANGLL NQRGGSNVGL NSEQDAEHPS SNLWGNSSSR GAWVQASSRD LNGHSQRRSP  420
SGNLFHHHEG SDFAQSRSSF IDLTNGDGLI KNPSLEFSLG RPDWHSKEVL D*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A7e-17282336458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B7e-17282336458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A6e-17282336357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B6e-17282336357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C6e-17282336357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D6e-17282336357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A7e-17282336458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C7e-17282336458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D7e-17282336458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F7e-17282336458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H7e-17282336458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J7e-17282336458Protein PHOSPHATE STARVATION RESPONSE 1
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna09331.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004299501.10.0PREDICTED: transcription repressor KAN1 isoform X1
TrEMBLA0A2P6P1N40.0A0A2P6P1N4_ROSCH; Putative transcription factor MYB-HB-like family
STRINGXP_004299501.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17563391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.13e-53G2-like family protein