PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna09110.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family bZIP
Protein Properties Length: 488aa    MW: 52096.4 Da    PI: 9.7723
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna09110.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_149.41e-15370420555
                              CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                              +r+rr++kNRe+A rsR+RK+a++ eLe +v++L++eN++Lkk+ +e+ ++
  mrna09110.1-v1.0-hybrid 370 RRQRRMIKNRESAARSRARKQAYTMELEAEVAKLKEENQELKKKQDEMMEL 420
                              79*****************************************99988775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.3E-15363419No hitNo description
SMARTSM003381.8E-13366431IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.484368419IPR004827Basic-leucine zipper domain
PfamPF001701.5E-13370420IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.19E-11370419No hitNo description
CDDcd147073.76E-27370424No hitNo description
PROSITE patternPS000360373388IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 488 aa     Download sequence    Send to blast
MGANMNFKGF MTDFQGDGGG RPPGINNNNN SNALAREASI YSLTFDELQN SMGGPGKDFG  60
SMNMDELLKS IWSAEETQTM VPSGVVTGGQ DGYSQGHLPL QRQGSLTLPR TLSQKTVDEV  120
WRNLSAKEEN GGTAGPKAPQ RQQTLGEMTL EEFLVRAGVV REDGQVGSKL GGSGFFGELA  180
RFGNGGGGGV GFGFQQPDRG SVGVMGSRIS ENGNQIGNLN SNMPLNANGV RSSQQQQQAP  240
QQQPQQLQIF PKQQPVTYST SQMALGPNSQ LGSPGMRGGI MGIGEQGINN ALVQSPVLQG  300
GGGGGMGMVG LGAGNGRVAA VSPANQLSSD GIGNGKSNGT DTSSVSPMPY VFNNGFRGRK  360
GGPVEKVVER RQRRMIKNRE SAARSRARKQ AYTMELEAEV AKLKEENQEL KKKQDEMMEL  420
QKNQLIDHLE FVNFAGYRDS KSSKRRQETL LETNTDRSMV KCRAWGSGLH CGKGGGCTYL  480
RIMCLVL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004291101.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5
RefseqXP_011458927.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5
SwissprotQ9M7Q41e-110AI5L5_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 5
TrEMBLM5XCV61e-152M5XCV6_PRUPE; Uncharacterized protein
STRINGVIT_18s0001g10450.t011e-128(Vitis vinifera)
STRINGPOPTR_0002s12710.11e-127(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF19623481
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G45249.14e-86abscisic acid responsive elements-binding factor 2