PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna08757.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family bZIP
Protein Properties Length: 367aa    MW: 39534.4 Da    PI: 5.5966
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna08757.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_153.26.3e-17166220357
                              XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                              ++kr rr+ +NRe+ArrsR+RK++ ++eLe  v+ L  eN++L  +l   ++++ 
  mrna08757.1-v1.0-hybrid 166 DIKRIRRMVSNRESARRSRRRKQQHLQELEGQVDILRVENSTLYRQLTDASQQYR 220
                              58*****************************************977776666665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512575118No hitNo description
SMARTSM003381.6E-16164228IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.289166218IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.13E-12167219No hitNo description
PfamPF001701.5E-13167218IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.4E-12168220No hitNo description
PROSITE patternPS000360171186IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0071333Biological Processcellular response to glucose stimulus
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
PO:0007134developmental stagesporophyte vegetative stage
Sequence ? help Back to Top
Protein Sequence    Length: 367 aa     Download sequence    Send to blast
MERNSAAVHS HTMFGSSCGG DHLKRSPSQL DFEECLQKIA RGVTAESHDR SFAETGDFFA  60
ETGDFFSGDL TFAFKNRDIM DGFSSSNGLM ETLLSPQNLT PKNSSISATM DSQSSICVGT  120
PTSAANPVGQ DNQARGATSG SSGDQSDEDD FDIEAGPCGD STDPLDIKRI RRMVSNRESA  180
RRSRRRKQQH LQELEGQVDI LRVENSTLYR QLTDASQQYR DADTNNRVLK SDVEALRAKV  240
KLAEDMVARG SLTSSFNQLL QGHLSIPQPL NPHTLRGVAH VSPTITIHGD DTSYAGIAVS  300
GQNSGMGLGN AAGMTNSNMG TRIMSDAEEP QCRRTINKAF HLNARQGSNE LSNGSNGVSN  360
LNLAND*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1180187RRSRRRKQ
2182187SRRRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004291263.10.0PREDICTED: basic leucine zipper 9
SwissprotQ9FUD32e-67BZIP9_ARATH; Basic leucine zipper 9
TrEMBLM5XPF81e-135M5XPF8_PRUPE; Uncharacterized protein
STRINGVIT_04s0008g02750.t011e-108(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41953458
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24800.15e-53basic leucine zipper 9