PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna08746.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family Trihelix
Protein Properties Length: 402aa    MW: 45961.6 Da    PI: 6.8245
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna08746.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix32.42.4e-1030100274
                 trihelix   2 WtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtse 74 
                              Wt+   l L++ +  +e + r++ +  ++W+ +++++ + g+ rs  q + kwe l  +yk i +++++    
  mrna08746.1-v1.0-hybrid  30 WTETDSLILVNEVAAVEADCRKEFSSFQKWKVIAQNCTALGVPRSLDQYRRKWEALLHQYKIIDHWNSQS--A 100
                              99999999***********************************************************984..2 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF138377.4E-729100No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009506Cellular Componentplasmodesma
Sequence ? help Back to Top
Protein Sequence    Length: 402 aa     Download sequence    Send to blast
MKGEQTLSEL HHANRGSGTR RTRSQVAPDW TETDSLILVN EVAAVEADCR KEFSSFQKWK  60
VIAQNCTALG VPRSLDQYRR KWEALLHQYK IIDHWNSQSA ASYWAMESDR RKQFGLPRSF  120
DHEVFKAIGG YEKVQENQSD TEVDSEPEAE ADVADDDEGA VEPDSKRRRR QSTQQKCKPI  180
QNPVRRSMVK RPIQKPRQTH AAEKPVQKAC QAQVEEKTAQ KNRQMRVEEK TIEKPVQTHV  240
TEKPGEKPRE THVEEKPHQT HEEEEPVEKA RQTHAQEKPV KKPCQTHVEG DPLKNPPKTL  300
AEENVVGKSC QTHAEEKHVE SCLEAIPMEN LAEEKLHQTH AEEKHMESCL EAIPMENLAE  360
EKLHQTHEEV KPVGSCLDAT PTKKLAEELP QKSCLKKKIR P*
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna08746.1-v1.0-hybrid
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004292870.20.0PREDICTED: LOW QUALITY PROTEIN: ABC transporter F family member 4
TrEMBLA0A2P6PZU60.0A0A2P6PZU6_ROSCH; Uncharacterized protein
STRINGXP_004292870.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF67322633
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31270.11e-42sequence-specific DNA binding transcription factors