PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna08566.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family bZIP
Protein Properties Length: 217aa    MW: 23379.2 Da    PI: 9.9966
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna08566.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_145.71.4e-14151193547
                              CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkk 47 
                               r +r++kNRe+A+rsR+RK+a++ eLe k + L++eN +L+ 
  mrna08566.1-v1.0-hybrid 151 VRHKRMIKNRESASRSRARKQAYTSELELKLELLKEENARLRM 193
                              699**************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.7E-7147206IPR004827Basic-leucine zipper domain
PfamPF001707.5E-12152194IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.0E-13152197No hitNo description
PROSITE profilePS5021710.14152194IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.19E-10152196No hitNo description
CDDcd147071.11E-14152203No hitNo description
PROSITE patternPS000360154169IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 217 aa     Download sequence    Send to blast
MTMEDVWKDI SLASLCDHSS PGAAGSSATR NDPAGVRGFI FQDFMAAAST KLAPSSLATD  60
LGPPPPANLL SLSSSGSDHF QQYQVHNSSA TTSTNTSAPP NLAKPNPDST TRPSSSLISF  120
SNKSALEALG SSSYCKKRAV EEENGENSRH VRHKRMIKNR ESASRSRARK QAYTSELELK  180
LELLKEENAR LRMQQQKFCL ATPVAPATTL KRAHSM*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004291338.11e-159PREDICTED: protein FD
TrEMBLA0A061FEF12e-35A0A061FEF1_THECC; Basic-leucine zipper transcription factor family protein, putative
STRINGPOPTR_0005s26480.13e-28(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF37553252
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35900.15e-15bZIP family protein