PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna08484.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family bZIP
Protein Properties Length: 535aa    MW: 57868.1 Da    PI: 6.2684
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna08484.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.53.8e-10388439556
                              CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 
                              kr++r   NR +A rs +RK  +i eLe kv++L++e ++L  ++ +l+  +
  mrna08484.1-v1.0-hybrid 388 KRAKRILANRQSAARSKERKMRYIVELEHKVQTLQTEATTLSAQVTKLQRDS 439
                              9*****************************************9999988665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.5E-18384448IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.668386449IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.7E-11388437No hitNo description
SuperFamilySSF579598.84E-11388438No hitNo description
PfamPF001704.8E-9388439IPR004827Basic-leucine zipper domain
CDDcd147034.43E-24389438No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
PO:0007134developmental stagesporophyte vegetative stage
Sequence ? help Back to Top
Protein Sequence    Length: 535 aa     Download sequence    Send to blast
MEGSDETSSG KQRPNSPFGS SPPASFARPN HHLDIPNFNS AQVGLPMRQL SPAPSPETTS  60
KRLGIPPSHP NNPMRPQPPS WSLSPSGGSA HSRSLSQPAF FSLDSLPPLS PLTSYREPTA  120
SSLSDPNSAD VNMEESVVNS HAQSMRSPVT DGNPFWAGDG LPPRRGHRRS NSDVPLGFSA  180
VIQSSPQLIP IGRRASFDGK EAAKPVQLVR QGSSGDNNGE LMGDRKSGGE VVDDLFSAYM  240
NLENIDRMNS PGGEDKDLDS RASGSKNGGE SSDNEVESGV NGKWSSSGFS SEKKEGGKRA  300
AGGDAGRTVR HCRSVSMDSY MDNLNFDDEL MKPLPLGSQV GQLSPSTSVD GNSAKFSMEF  360
GSGEFNAIEL KKIMESEKLS EIAVSDPKRA KRILANRQSA ARSKERKMRY IVELEHKVQT  420
LQTEATTLSA QVTKLQRDSM GFTSENNELK FRLQAMEQQA QLKDALNEAL TGEVQRLRIS  480
AAELGGEGNL SNRMSQQLSI NQQMLQLQQL NLYQMHQQPQ QQTGFSDVGL CCEC*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004291397.10.0PREDICTED: transcription factor RF2a-like
TrEMBLM5XNC00.0M5XNC0_PRUPE; Uncharacterized protein
STRINGVIT_03s0038g00860.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF22723484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.31e-103bZIP family protein