PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna08317.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family G2-like
Protein Properties Length: 514aa    MW: 56209.5 Da    PI: 5.7636
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna08317.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.57.4e-34287341155
                  G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                              kpr+rWtpeLHe+Fveav+qLGGse+AtPk +l+lmkv++Lt++hvkSHLQkYR+
  mrna08317.1-v1.0-hybrid 287 KPRMRWTPELHESFVEAVNQLGGSERATPKGVLKLMKVESLTIYHVKSHLQKYRT 341
                              79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.092284344IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-31285343IPR009057Homeodomain-like
SuperFamilySSF466897.53E-18286341IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-24287341IPR006447Myb domain, plants
PfamPF002493.5E-9289340IPR001005SANT/Myb domain
PfamPF143795.5E-26372419IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0016036Biological Processcellular response to phosphate starvation
GO:0055063Biological Processsulfate ion homeostasis
GO:0071486Biological Processcellular response to high light intensity
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
PO:0007134developmental stagesporophyte vegetative stage
Sequence ? help Back to Top
Protein Sequence    Length: 514 aa     Download sequence    Send to blast
MEARPAIRRS TANSHMGVSG ALSSSTPVLQ SPSQETYPKL QDSQQVSMER SVVHAGHLTS  60
NSGVIGHIIS SPSRFSTDLH YSSISPREKQ SRKSPFISQS SSSASIPLSH SSPSEAFQST  120
ASCAYSKENS HSWGTDSLPG FLDFPVNTPV QNSQIESSSC SGIMAAADEW QEWASQLVTD  180
DDALTSNWSD LLVDDNVTNL EPKMTYQVPK PSLNFSAQQS LVSQQDPASS REPSLNFSAQ  240
QSQVSQQHPA SSTEIIPAPS REILPGQSKD IISVTTTPSS ANSAAAKPRM RWTPELHESF  300
VEAVNQLGGS ERATPKGVLK LMKVESLTIY HVKSHLQKYR TARYRPDSSE GSLEKKLTPL  360
EEMTSLDLKT GIEITEALRL QMEVQKRLHE QLEIQRNLQL RIEEQGKYLQ MMFEKQCKSS  420
IDNMNASSSG VENPSAQPSE AMQVSPDKSE LETSKVEHDK TKHDPAKSIV ASAECAEEPI  480
GKQKSPETEA PTDSEPDVCM SSSQPPKRPK IKE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-30286345160Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-30286345160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-30286345160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-30286345160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-30286345160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-30286345160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-30286345160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-30286345160Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna08317.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004289982.10.0PREDICTED: protein PHR1-LIKE 1-like
TrEMBLA0A2P6PV100.0A0A2P6PV10_ROSCH; Putative transcription factor MYB-HB-like family
STRINGXP_004289982.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15123498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28610.14e-91phosphate starvation response 1