PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna08186.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family bZIP
Protein Properties Length: 426aa    MW: 46306.8 Da    PI: 6.5143
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna08186.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_152.31.3e-16214267356
                              XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 
                              ++kr+rr+ +NRe+ArrsR+RK+a++  Le+ + +L  eN+aL k+l   + ++
  mrna08186.1-v1.0-hybrid 214 DVKRARRMLSNRESARRSRRRKQAQMTDLETQAGQLRVENSALLKQLTDVNHKY 267
                              78******************************************9887766655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.5E-15212276IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.2E-11213265No hitNo description
PROSITE profilePS5021710.864214268IPR004827Basic-leucine zipper domain
PfamPF001706.1E-14215268IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.19E-11215266No hitNo description
PROSITE patternPS000360219234IPR004827Basic-leucine zipper domain
PfamPF124989.6E-23283398IPR020983Basic leucine-zipper, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0002240Biological Processresponse to molecule of oomycetes origin
GO:0009626Biological Processplant-type hypersensitive response
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000693Biological Processpositive regulation of seed maturation
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 426 aa     Download sequence    Send to blast
MHSAFPADEI SDISDTFWAS SPSLPMNRSA SEWAFEQFLE EVVSPPPPPP PPPPAASAHS  60
STSKREEVDE EVVEIKKPDR LQQQHLNCPP PPPSDPPSTA QINSDQYREL LKSKLNLACA  120
AVALTRASSL KPVDSDNVAQ TQSVAPQPSQ LTTGLHKKGA GLPQSEADTS PLGIPALPAI  180
QKKAQTTSGS SKDDSDDDDL EGDIEITENM DPADVKRARR MLSNRESARR SRRRKQAQMT  240
DLETQAGQLR VENSALLKQL TDVNHKYDNS VVDRRILEAN IETLRAKVKM AEESVKRKTG  300
INPLLLAMSN VVPRASMASI GNPMDASANS SVPMQPTSNH LFHPVAPNIN TPPHHQRLDT  360
TFPGNHSIPL VGNQQRGSNT TEVPSVQHTA SIDHMHQQQL LPGANPCEAL PGWNPQIPHQ  420
VPKNK*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1228235RRSRRRKQ
2230235SRRRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004289896.10.0PREDICTED: light-inducible protein CPRF2 isoform X1
TrEMBLM5VVS71e-144M5VVS7_PRUPE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF136911825
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02640.12e-48bZIP family protein