PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna08175.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family Trihelix
Protein Properties Length: 659aa    MW: 73611.4 Da    PI: 7.0361
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna08175.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix91.96.4e-2985168186
                 trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                              rW++qe+laL+++r++m+ ++r+++ k+plW+evs+k++e gf+rs+k+Ckek+en+ k+++++keg+ ++++++  t+++fdql+
  mrna08175.1-v1.0-hybrid  85 RWPRQETLALLKIRSDMDVAFRDASVKGPLWDEVSRKLAELGFHRSAKKCKEKFENVYKYHRRTKEGRTGKSEGK--TYRFFDQLQ 168
                              8********************************************************************975544..6******98 PP

2trihelix101.66.1e-32476560186
                 trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                              rW++ ev+ Li++r++++++++++  k+plWee+s+ m++ g++rs+k+Ckekwen+nk++kk+ke++kkr +e+s+tcpyf+ l+
  mrna08175.1-v1.0-hybrid 476 RWPRVEVHSLIKLRTSLDSKYQENGPKGPLWEEISAGMKKLGYNRSAKRCKEKWENINKYFKKVKESNKKR-PEDSKTCPYFHLLD 560
                              8*********************************************************************8.99*********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007176.0E-482144IPR001005SANT/Myb domain
PROSITE profilePS500906.82984142IPR017877Myb-like domain
PfamPF138371.1E-1884170No hitNo description
CDDcd122037.80E-2384149No hitNo description
PROSITE profilePS500906.934469533IPR017877Myb-like domain
SMARTSM007170.26473535IPR001005SANT/Myb domain
CDDcd122039.04E-29475540No hitNo description
PfamPF138374.6E-22475562No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010192Biological Processmucilage biosynthetic process
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 659 aa     Download sequence    Send to blast
MSDQLSMIKV KRDRERGYPM LGDLGSSSDA TTATATAVKP FGAHEGGGGD GGVGSNSGEE  60
EKNSYSRGGG GGGDDFGDRS FGGNRWPRQE TLALLKIRSD MDVAFRDASV KGPLWDEVSR  120
KLAELGFHRS AKKCKEKFEN VYKYHRRTKE GRTGKSEGKT YRFFDQLQAL ENQPPTPTTP  180
NSTTTHQPRP QPTIAMAVSN PPPLPTISHI NSTSTNSTNT VPSAAPHQGI ATPTIPSSLF  240
PPTNPITFTP PPQPPPQQNP TSHHQHHQAT TFVPPSTFPS ISSTDLMSNS TSSSTSSDEE  300
MEGRAKRKRK WKDFFETLMK QVVYKQEDLQ KRFLEAIEKR EHERMAREEA WRMQEMARIN  360
REREILAQER SIAAAKDSAV MSFLQKIAEQ QHNPQATPTI TPNNHLVTSH PPQPHPPPAQ  420
QPAPPPQRQQ TTPPPPALQI TQAPITSFEI TPRANGESNN DNNNMVSATT TPSSSRWPRV  480
EVHSLIKLRT SLDSKYQENG PKGPLWEEIS AGMKKLGYNR SAKRCKEKWE NINKYFKKVK  540
ESNKKRPEDS KTCPYFHLLD SLYKERNNKY FDQMGNNNNN NDNNNSPKPE NNAAPMMVRP  600
EQQWQPPRVE PEMDQNHEEE ERDGDEDEDE DDEEDEGNYE IVANKGASVS VGASATAE*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00243DAPTransfer from AT1G76880Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna08175.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004290520.10.0PREDICTED: trihelix transcription factor GT-2
TrEMBLA0A2H4NFX10.0A0A2H4NFX1_FRAAN; Trihelix transcription factor GT-2B
STRINGXP_004290520.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF37334181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.17e-95Trihelix family protein