PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna08173.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family Trihelix
Protein Properties Length: 579aa    MW: 65763 Da    PI: 6.6494
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna08173.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix92.83.4e-2963147187
                 trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                              rW++qe+laL+++r++m+ ++r+++lk+plWe+vs+k+ e g++rs+k+Ckek+en+ k+++++keg++++  ++ +t+++fd+le
  mrna08173.1-v1.0-hybrid  63 RWPRQETLALLKIRSQMDPAFRDSSLKAPLWEDVSRKLGELGYQRSAKKCKEKFENVYKYHRRTKEGRSGK--PEGKTYRFFDELE 146
                              8********************************************************************95..55568******98 PP

                 trihelix  87 a 87 
                              a
  mrna08173.1-v1.0-hybrid 147 A 147
                              5 PP

2trihelix102.62.9e-32415500187
                 trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                              rW+k ev+aLi++r++++ +++++  k+ lWee+s+ mr+ g++rs+k+Ckekwen+nk++kk+ke++k r +e+s+tcpyf+qle
  mrna08173.1-v1.0-hybrid 415 RWPKTEVQALIDLRTSLDVKYQDAGPKGSLWEEISAGMRRLGYNRSSKRCKEKWENINKYFKKVKESSKTR-PEDSKTCPYFHQLE 499
                              8********************************************************************97.99***********8 PP

                 trihelix  87 a 87 
                              a
  mrna08173.1-v1.0-hybrid 500 A 500
                              5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.005360122IPR001005SANT/Myb domain
PROSITE profilePS500906.93462120IPR017877Myb-like domain
PfamPF138371.3E-1862147No hitNo description
CDDcd122031.94E-2462127No hitNo description
SMARTSM007174.1E-4412474IPR001005SANT/Myb domain
PROSITE profilePS500907.584414472IPR017877Myb-like domain
PfamPF138373.5E-22414501No hitNo description
Gene3DG3DSA:1.10.10.604.8E-4414471IPR009057Homeodomain-like
CDDcd122037.22E-28414479No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
PO:0007134developmental stagesporophyte vegetative stage
Sequence ? help Back to Top
Protein Sequence    Length: 579 aa     Download sequence    Send to blast
MMVAEEPAVL LHDEGGCSNT ETAAVLFSNS GAEDHDKHTF GDVDQEGGHD DDHRSYGGGG  60
GNRWPRQETL ALLKIRSQMD PAFRDSSLKA PLWEDVSRKL GELGYQRSAK KCKEKFENVY  120
KYHRRTKEGR SGKPEGKTYR FFDELEAFDH QQNSHNLSII PPKPPVVLWT NNSNHHPNQS  180
VPPPVVTVPQ NGVTPATDPI IHSSTNNSLL PQQIHSSQDN TNGFRLLNPT TNLFSSSTSS  240
TTASDEEFQQ RNKRKRKWKY FFRRLTKQVL EKQERLQENF LEAIAKCDQE RMVKEEAWRM  300
QEMARIDRDH EVLVQERSSA AAKDAALIQF LQKVSLQHNS NDTRSLEIND ATAMLVIPPP  360
TNVPRPPLPA LPVSWAIDQR GLTASSDGAV APRNLEAKKV YGNGENNSAV MGSSRWPKTE  420
VQALIDLRTS LDVKYQDAGP KGSLWEEISA GMRRLGYNRS SKRCKEKWEN INKYFKKVKE  480
SSKTRPEDSK TCPYFHQLEA LYRNKNNNKI EYHKDRSVEK LQIVQQPLRE NVDPNQEEDE  540
HDDHGDQDGE STEEDQEHDQ IGGTVTSYKQ SSMEMVES*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that binds specific DNA sequence. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00244DAPTransfer from AT1G76890Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna08173.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004290519.10.0PREDICTED: trihelix transcription factor GT-2-like
SwissprotQ391171e-135TGT2_ARATH; Trihelix transcription factor GT-2
TrEMBLA0A2H4NFW40.0A0A2H4NFW4_FRAAN; Trihelix transcription factor GT-2A
STRINGXP_004290519.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF37334181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76890.21e-130Trihelix family protein