PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna07554.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family bZIP
Protein Properties Length: 271aa    MW: 29591 Da    PI: 6.391
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna07554.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_127.56.9e-0996140751
                              HHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   7 errkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 
                               +r   NReA r++R++Kka+ + Le++v  L a N++L k+l+ 
  mrna07554.1-v1.0-hybrid  96 KKRPLGNREAVRKYREKKKARAASLEDEVIRLRAVNQQLMKRLQG 140
                              467788**********************************99974 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1709.5E-1488158No hitNo description
SMARTSM003386.6E-989157IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.7692139IPR004827Basic-leucine zipper domain
PfamPF077164.4E-1492147IPR004827Basic-leucine zipper domain
SuperFamilySSF579598.13E-795139No hitNo description
CDDcd146866.66E-1296149No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0071294Biological Processcellular response to zinc ion
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009001anatomyfruit
PO:0007010developmental stagewhole plant fruit ripening stage
PO:0007027developmental stagewhole plant fruit formation stage 70% to final size
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MDDGELDFSN QELDFSIPNM TGELPSSCSM ENIFGDFFKE TDTACTHNHI CNPPSGPDSA  60
HRHTCIHVHT KILSSGASED KAGTDDTAES GEKNSKKRPL GNREAVRKYR EKKKARAASL  120
EDEVIRLRAV NQQLMKRLQG QAALEAEIAR LKCLLVDIRG RIEGEIGSFP YQKPVNPGMQ  180
NPNYSSAYVM NPCNMQCDDQ LYCLQRGNDG KRGDGVAMNG QGFSGCEFEN LQCFTNQDGG  240
SMGLSGCDLG NVMLESNGSH SGTKKRKGKN *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004289872.10.0PREDICTED: uncharacterized protein LOC101314521
SwissprotQ8GTS21e-103BZP23_ARATH; Basic leucine zipper 23
TrEMBLM5VMR71e-136M5VMR7_PRUPE; Uncharacterized protein
STRINGVIT_03s0038g02420.t011e-118(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF25673277
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16770.13e-90bZIP family protein