PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna06692.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family SBP
Protein Properties Length: 938aa    MW: 104197 Da    PI: 7.7604
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna06692.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP116.31.7e-36157233177
                              --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                      SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                              +Cqv+ C ad++e+k yhrrh+vC ++++a++v+++g ++r+CqqC++fh ls+fDe+krsCrr+L++hn+rrr+k 
  mrna06692.1-v1.0-hybrid 157 RCQVPTCGADIKELKGYHRRHRVCLACANATTVVIDGDSKRYCQQCGKFHVLSDFDEGKRSCRRKLERHNNRRRRKP 233
                              6***********************************************************************99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.4E-28154219IPR004333Transcription factor, SBP-box
PROSITE profilePS5114129.214155232IPR004333Transcription factor, SBP-box
SuperFamilySSF1036124.32E-33156235IPR004333Transcription factor, SBP-box
PfamPF031105.5E-27158232IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0055070Biological Processcopper ion homeostasis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 938 aa     Download sequence    Send to blast
MSSLLPHLVI LILTLNAMQR SPPSLSPTHS QLHPRVSPPP MAAAGDPSAV WDWGDLLDFT  60
VDSDLSISWA PDDPPNPLPP PPQEDPNPNS SPNPDLSPGA PRIRKRDPRL ACSNFLAGHV  120
PCACPEVDEK MMELEEEEAG HGKKRVRTVR APPGTARCQV PTCGADIKEL KGYHRRHRVC  180
LACANATTVV IDGDSKRYCQ QCGKFHVLSD FDEGKRSCRR KLERHNNRRR RKPSDSKLGK  240
ESQKEVHVED GNHDVEAGED SLQLSSQINE KEELLESEGG GISTLFSMPN AQNVGSDSVP  300
SVLTPSDTQM DGRKHDSNHS LSPPQSDNKS AYSSMCPTGR ISFKLYDWNP AEFPRRLRHQ  360
IFQWLASMPV ELEGYIRPGC TILTVFIAMP NFMWMKLLDD PASYLHNFVI VPGMMLSGRG  420
NMLVYLNDII FRVVKDGTSV IKAKVEVRAP KLHYIHPTCF EAGKPMEFVV CGSNLLQPKL  480
RFLVSFSGKY LADNYDPESS HSQIERDSTA GNLDHQFYKI HVPHTEATSF GPAFIEVENE  540
SGLSNFLPVL VGNKEICAEM ETIQKRLEES LFVRGSSDVS SSGCLLNSCE ASSLRHRAFS  600
EIILDIAWLL RKPSSENVQH IMTSSQAQRF NHLLNLLIFF KSTTILEKVL ENLKTLMDNV  660
EINNPNSGSI DADMRLLQKY MDHARDILCQ KLRYSGVSQL ELESLVHKGD VISQSRSCFQ  720
SKQHFPIHTQ DTEITVDGKM DVMLGSTSNE KSETLPLLNK KAAMKVNFIK HANCGNSSGE  780
LLGFRSRRTF LGFRPTLYVI SAAAMCLGIC AVVFHPHKTL YALKGKIHLQ QMVRMHYCRR  840
SADVPPFATV RRRRGRASTP ADSSSVLDHF PSPASPPNSS FLTRSTLFEV LGDLAGKLKF  900
GGLAGEGKWS EMLLESAGVE ESPRWRRTVA NGGTSAL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul5_A2e-42156235483squamosa promoter binding protein-like 7
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1218230RRKLERHNNRRRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00604PBMTransfer from AT5G18830Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna06692.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004296778.20.0PREDICTED: squamosa promoter-binding-like protein 7
TrEMBLA0A2P6QXU80.0A0A2P6QXU8_ROSCH; Putative transcription factor SBP family
STRINGXP_004296778.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF64703450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18830.30.0squamosa promoter binding protein-like 7