PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna06295.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family SBP
Protein Properties Length: 412aa    MW: 45505 Da    PI: 8.8673
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna06295.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP132.11.9e-4197173278
                              -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                      SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                              C v+gC++dls++++yhrrhkvCe hsk+p+v+++g++qrfCqqCsrfh+l+efDe+krsCr+rL++hn+rrrk+q+
  mrna06295.1-v1.0-hybrid  97 CLVDGCRSDLSTCRDYHRRHKVCELHSKTPMVTINGQKQRFCQQCSRFHSLEEFDEGKRSCRKRLDGHNRRRRKPQP 173
                              **************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.0E-3390158IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.89894171IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.19E-3895176IPR004333Transcription factor, SBP-box
PfamPF031108.8E-3197170IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 412 aa     Download sequence    Send to blast
MDWNMKASSS WDLSELEQAT FSNLDTVNES SSFGDQHRAI KGDFSVDLKL GQLGDSGNNQ  60
LLDMFKQHGG PKPSSSSPSG ASKRSRAAYN GSHTVSCLVD GCRSDLSTCR DYHRRHKVCE  120
LHSKTPMVTI NGQKQRFCQQ CSRFHSLEEF DEGKRSCRKR LDGHNRRRRK PQPEPLSRSG  180
SFLSNYQGTQ LSPFSSSLVY PSTTVVNPTW AAVVKAEADT GHHNQHLQHH NMFLGSSTRS  240
SSSYNKGGAN KQQFTLFQSS NNNQTHGASV CQPLLNTISM SDTASSGAAA SAKSKLCHDR  300
LTTTRILHDS DCALSLLSSP QTQQQTSELG LRHMMQQPNT TSLMHHHRLG FHRNNNSNNI  360
EPMDSVRVSH GSSDDAHNVH QSSGIFHMGS DGSQQGNHHH QGSQTLPFHW Q*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-27971701184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1153170KRSCRKRLDGHNRRRRKP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00555DAPTransfer from AT5G50570Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna06295.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004297529.10.0PREDICTED: squamosa promoter-binding-like protein 13A
TrEMBLA0A2P6P4U90.0A0A2P6P4U9_ROSCH; Putative transcription factor SBP family
STRINGXP_004297529.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF25913378
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.11e-69SBP family protein