PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna05590.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family HD-ZIP
Protein Properties Length: 278aa    MW: 31139.9 Da    PI: 8.3041
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna05590.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.91.7e-18129183256
                              T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                 Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                              rk+ ++tkeq   Lee F+++++++ ++++ LA++l+L  rqV vWFqNrRa+ k
  mrna05590.1-v1.0-hybrid 129 RKKLRLTKEQSALLEESFKQHSTLNPKQKQALARQLSLRPRQVEVWFQNRRARTK 183
                              788899***********************************************98 PP

2HD-ZIP_I/II125.72e-40129218191
              HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekevee 86 
                              +kk+rl+keq++lLEesF+++++L+p++K++lar+L l+prqv+vWFqnrRARtk+kq+E+d+e+Lk+++++l++en+rL+kev+e
  mrna05590.1-v1.0-hybrid 129 RKKLRLTKEQSALLEESFKQHSTLNPKQKQALARQLSLRPRQVEVWFQNRRARTKLKQTEVDCEFLKKCCETLTDENRRLQKEVQE 214
                              69************************************************************************************ PP

              HD-ZIP_I/II  87 Lreel 91 
                              L+ +l
  mrna05590.1-v1.0-hybrid 215 LK-AL 218
                              *9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.2E-18108183IPR009057Homeodomain-like
SuperFamilySSF466891.92E-18118186IPR009057Homeodomain-like
PROSITE profilePS5007117.443125185IPR001356Homeobox domain
SMARTSM003893.9E-15127189IPR001356Homeobox domain
PfamPF000467.0E-16129183IPR001356Homeobox domain
CDDcd000864.42E-16129186No hitNo description
PROSITE patternPS000270160183IPR017970Homeobox, conserved site
SMARTSM003401.4E-23185230IPR003106Leucine zipper, homeobox-associated
PfamPF021831.1E-10185219IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009735Biological Processresponse to cytokinin
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
PO:0007134developmental stagesporophyte vegetative stage
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MGFDDQHACN TGLVLGLGLT ASQYSTSTPT PQKAQHPMMN KKPDSFEPSL TLGLFGNSFH  60
EDDHHQGNNS LDLYRQGSPH NSHSAVSNSF SSGRVVKRER DISSEEVEVE KQVSSRVISD  120
EDEDGPNARK KLRLTKEQSA LLEESFKQHS TLNPKQKQAL ARQLSLRPRQ VEVWFQNRRA  180
RTKLKQTEVD CEFLKKCCET LTDENRRLQK EVQELKALKL SQQQPLFMHM PAATLTMCPS  240
CERIGGSEGA NSNKSPFSIA HPKPHFYNPF TNSSAAC*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1177185RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00477DAPTransfer from AT4G37790Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna05590.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004288289.10.0PREDICTED: homeobox-leucine zipper protein HAT9-like
SwissprotP466044e-95HAT22_ARATH; Homeobox-leucine zipper protein HAT22
TrEMBLA0A2P6RPG90.0A0A2P6RPG9_ROSCH; Putative transcription factor Homobox-WOX family
STRINGXP_004288289.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF114433107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.12e-92HD-ZIP family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Liu T,Longhurst AD,Talavera-Rauh F,Hokin SA,Barton MK
    The Arabidopsis transcription factor ABIG1 relays ABA signaled growth inhibition and drought induced senescence.
    Elife, 2017.
    [PMID:27697148]
  3. Song L, et al.
    A transcription factor hierarchy defines an environmental stress response network.
    Science, 2017.
    [PMID:27811239]