PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna05518.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family G2-like
Protein Properties Length: 489aa    MW: 53312.3 Da    PI: 5.8751
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna05518.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like105.23.7e-33255309155
                  G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                              +pr+rWtpeLHerFveav++L G+ekAtPk++l++m+v+gLt++hvkSHLQkYRl
  mrna05518.1-v1.0-hybrid 255 RPRMRWTPELHERFVEAVKKLDGAEKATPKAVLKVMNVEGLTIYHVKSHLQKYRL 309
                              59****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.007252312IPR017930Myb domain
SuperFamilySSF466891.56E-17254309IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.1E-31254310IPR009057Homeodomain-like
TIGRFAMsTIGR015575.4E-25256310IPR006447Myb domain, plants
PfamPF002494.8E-10257308IPR001005SANT/Myb domain
PfamPF143792.7E-23345392IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
PO:0007134developmental stagesporophyte vegetative stage
Sequence ? help Back to Top
Protein Sequence    Length: 489 aa     Download sequence    Send to blast
MKVGLSSAIM SLHGVSSVTQ SGTTKGITQS YCTSLSPAHD FLGCESEGRN SVAHECSSTR  60
LSPFMRTESF SSPTNMRESS LQRVKSTFSR SSVFCTSLYQ SSSSTSETSR QLGNLPFLPH  120
PPTYSQSNSA VDSTSPLLLS QDMSNQYDDE QSDYLMKDFL NMTGDASDGS FHEIGCGSDT  180
MALTEQLEFQ FLSDQLDIAI TDNGENPRLD EIYDIPRASS EPTIELTCSK SCGSTAPLVD  240
ALSSHPSPGP SSAHRPRMRW TPELHERFVE AVKKLDGAEK ATPKAVLKVM NVEGLTIYHV  300
KSHLQKYRLA KYMPEKKEDK KASSSEEKKA ASSGNESDGR RKGSIHITEA LRMQMEVQKQ  360
LHEQLEVQRS LQLRIEEHAK YLEKILEEQQ KAGSALLSPQ ALSSLTTNSL KDSEQQPPPS  420
ACISASQPAA SDSSSPDSPL SLKHKAAACS ESEAHAYTKK LRIEEKPDDP VVENPSATVT  480
TTPTTTSQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A9e-25255312259Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B9e-25255312259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A9e-25255312259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C9e-25255312259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D9e-25255312259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F9e-25255312259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H9e-25255312259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J9e-25255312259Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00354DAPTransfer from AT3G13040Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna05518.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011467504.10.0PREDICTED: protein PHR1-LIKE 1
RefseqXP_011467505.10.0PREDICTED: protein PHR1-LIKE 1
SwissprotQ949U21e-148PHL6_ARATH; Myb family transcription factor PHL6
TrEMBLA0A2P6RZF10.0A0A2P6RZF1_ROSCH; Putative transcription factor MYB-HB-like family
STRINGXP_004303787.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF134691925
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13040.21e-117G2-like family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Nguyen HT, et al.
    A Transcription Factor γMYB1 Binds to the P1BS cis-Element and Activates PLA2-γ Expression with its Co-Activator γMYB2.
    Plant Cell Physiol., 2016. 57(4): p. 784-97
    [PMID:26872838]