PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna04786.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family SBP
Protein Properties Length: 404aa    MW: 45207.6 Da    PI: 10.0082
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna04786.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.94.6e-41168245178
                              --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                      SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                              +Cq+egC+adls+ak+yhrrhkvCe+hska++v+++gl+qrfCqqCsrfh l efD++krsCr+rLa+hn+rrrk+q+
  mrna04786.1-v1.0-hybrid 168 RCQAEGCHADLSQAKHYHRRHKVCEFHSKASTVIANGLTQRFCQQCSRFHLLAEFDNGKRSCRKRLADHNRRRRKSQQ 245
                              6**************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.107.5E-35164230IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.282166243IPR004333Transcription factor, SBP-box
SuperFamilySSF1036126.28E-38167246IPR004333Transcription factor, SBP-box
PfamPF031101.0E-30169242IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009554Biological Processmegasporogenesis
GO:0009556Biological Processmicrosporogenesis
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 404 aa     Download sequence    Send to blast
MLDYEWANPS SVILDGSESV NGSDPNRHLH HHNGILDHYA TTQVAFNNLL PPQPQQQQHS  60
AFAQHFGQSQ TQAHQVHSLF DPSVFASASS YAPTTHHHSM LSLDPSIPGH HGLMLIPKSE  120
DMCPPTDFAT RIGLNLGGRT YFSSEDDFMN RLYRRSRPAD HGPLNSPRCQ AEGCHADLSQ  180
AKHYHRRHKV CEFHSKASTV IANGLTQRFC QQCSRFHLLA EFDNGKRSCR KRLADHNRRR  240
RKSQQPSQEN RSSQPLSETA RNSSSDNVTK SPGESAGHSS SAVTVALSPP RIGLDCFRPR  300
LQTTTSSGSS SSLFFSRGRN RKRSVDKVSW KFPKPVESGQ FCLFPGKAFV AMELSWVCLG  360
AGIFRVKMRR WEKEEGREKR VRKKEKSSCL LNGSCTNQQA QSC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-291692421184squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. Binds specifically to the 5'-GTAC-3' core sequence. Involved in development and floral organogenesis. Required for ovule differentiation, pollen production, filament elongation, seed formation and siliques elongation. Also seems to play a role in the formation of trichomes on sepals. May positively modulate gibberellin (GA) signaling in flower. {ECO:0000269|PubMed:12671094, ECO:0000269|PubMed:16095614, ECO:0000269|PubMed:17093870}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00090SELEXTransfer from AT1G02065Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna04786.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004308485.10.0PREDICTED: squamosa promoter-binding-like protein 8
RefseqXP_011469198.10.0PREDICTED: squamosa promoter-binding-like protein 8
SwissprotQ8GXL36e-74SPL8_ARATH; Squamosa promoter-binding-like protein 8
TrEMBLA0A2P6SFL60.0A0A2P6SFL6_ROSCH; Putative transcription factor SBP family
STRINGXP_004308485.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68013348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02065.12e-74squamosa promoter binding protein-like 8
Publications ? help Back to Top
  1. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  2. Xing S, et al.
    SPL8 Acts Together with the Brassinosteroid-Signaling Component BIM1 in Controlling Arabidopsis thaliana Male Fertility.
    Plants (Basel), 2013. 2(3): p. 416-28
    [PMID:27137384]