PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna04784.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family SBP
Protein Properties Length: 226aa    MW: 24409.4 Da    PI: 7.9565
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna04784.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP71.71.4e-22168215148
                              --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSS CS
                      SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsr 48 
                              +CqvegC++ l +akeyhrrhkvCe+hska++v+v gleqrfCqqCsr
  mrna04784.1-v1.0-hybrid 168 RCQVEGCQVALVSAKEYHRRHKVCEMHSKASKVVVLGLEQRFCQQCSR 215
                              6**********************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.106.5E-24163215IPR004333Transcription factor, SBP-box
PROSITE profilePS5114119.666166225IPR004333Transcription factor, SBP-box
SuperFamilySSF1036126.02E-22167215IPR004333Transcription factor, SBP-box
PfamPF031109.5E-18169215IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MEMFGQTIGG RAGQNGNNAN LAWDIWEMNN GGNSNSNGNN DILYMTAATA AVTIVEPPSG  60
STASSEASLG HALMHNDGVQ AVEQHFQNFY GGDHHHHGRL HGSQYLPDPH LMCLKLGKRH  120
YFEDAAPPLL DHHHRHVAGF PLAMKRGKNL YGAGGGGGAS TSSLKVPRCQ VEGCQVALVS  180
AKEYHRRHKV CEMHSKASKV VVLGLEQRFC QQCSRSVLSE QLFSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A8e-15157215157squamosa promoter binding protein-like 4
1wj0_A4e-15169222659squamosa promoter-binding protein-like 12
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna04784.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004308484.11e-143PREDICTED: squamosa promoter-binding-like protein 7
TrEMBLA0A2P6SFK88e-99A0A2P6SFK8_ROSCH; Putative transcription factor SBP family
STRINGXP_004308484.11e-142(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96132738
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G27370.49e-24squamosa promoter binding protein-like 10