PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna04565.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family SBP
Protein Properties Length: 501aa    MW: 55986.2 Da    PI: 7.1855
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna04565.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP131.33.5e-41163239177
                              --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                      SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                              +Cqv+gC++dls+ keyh+rh+vC++hsk++ v+v+g+eqrfCqqCsrfh l efD+ krsCrrrLa+hn+rrrk+q
  mrna04565.1-v1.0-hybrid 163 TCQVHGCNMDLSSSKEYHKRHRVCDAHSKTAIVIVNGIEQRFCQQCSRFHLLAEFDDVKRSCRRRLAGHNQRRRKPQ 239
                              6**************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.2E-32159225IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.094161238IPR004333Transcription factor, SBP-box
SuperFamilySSF1036125.49E-38162243IPR004333Transcription factor, SBP-box
PfamPF031102.3E-31164237IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010468Biological Processregulation of gene expression
GO:0042742Biological Processdefense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 501 aa     Download sequence    Send to blast
MEPWSFGSEG KGFLFADEMD IPIDAFAKST KAFLEWDNKT CFNFDKESVE SMEFMDSGLP  60
DTMKEPFHGN QVVDILSGVG CNDSSNNTVA SPTCLMTSSS SWGDGESGSK FSSPVCESSS  120
QDSSLIALKL GRLADSKYGK DSQHLKERSK RARTKGSYYQ TITCQVHGCN MDLSSSKEYH  180
KRHRVCDAHS KTAIVIVNGI EQRFCQQCSR FHLLAEFDDV KRSCRRRLAG HNQRRRKPQL  240
DTFDCKSHNW LQSYQGIGYL GTSLPKRTPF VFSDILPGGV LYPEESNQYG HIKTEDELTY  300
SQCVTRTSNR QSIPNSFLHL HGLAKQHASG VPISGHEYSV FDTASDVQKE SGASTYQGVL  360
SLLSSQSQSS IHSARNQVAT PLQMQRTHHG AGQNNEWPST VKALEKCGRN GSFPCRMNSM  420
GTDQMDSVMI SDSSHAVDFQ HRTDRVQGSA CFSHKYHLSP ENGPTFDLLQ LSSHFQRVEQ  480
ERNFLQVKQE QGDFYCFPQS *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-271642371184squamosa promoter binding protein-like 4
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna04565.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4634662e-42AM463466.1 Vitis vinifera, whole genome shotgun sequence, contig VV78X160637.12, clone ENTAV 115.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004297216.10.0PREDICTED: squamosa promoter-binding-like protein 6
TrEMBLA0A2P6R2L50.0A0A2P6R2L5_ROSCH; Putative transcription factor SBP family
STRINGXP_004297216.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18193493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.17e-47SBP family protein