PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna04504.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family bZIP
Protein Properties Length: 586aa    MW: 64648.6 Da    PI: 7.2025
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna04504.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_145.22e-1495152562
                              CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                              +++rr+++NRe+ArrsR RK++ ++eL   v  L +eN++L+++l++ ++  +k+  e
  mrna04504.1-v1.0-hybrid  95 RKQRRMISNRESARRSRMRKQKHLDELWSQVLRLRTENHSLIDRLNHVSESHDKVLEE 152
                              79********************************************999988887766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.1E-1691155IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.85293156IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.01E-1295144No hitNo description
Gene3DG3DSA:1.20.5.1701.6E-1295168No hitNo description
PfamPF001701.4E-1295153IPR004827Basic-leucine zipper domain
CDDcd147021.03E-2396147No hitNo description
PROSITE patternPS00036098113IPR004827Basic-leucine zipper domain
SuperFamilySSF511264.57E-81259573IPR011050Pectin lyase fold/virulence factor
Gene3DG3DSA:2.160.20.103.5E-81269560IPR012334Pectin lyase fold
PfamPF002951.7E-71272562IPR000743Glycoside hydrolase, family 28
SMARTSM00710200363389IPR006626Parallel beta-helix repeat
SMARTSM00710990390411IPR006626Parallel beta-helix repeat
SMARTSM007107600413433IPR006626Parallel beta-helix repeat
SMARTSM00710130439460IPR006626Parallel beta-helix repeat
SMARTSM007103400470491IPR006626Parallel beta-helix repeat
SMARTSM007108600504531IPR006626Parallel beta-helix repeat
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005975Biological Processcarbohydrate metabolic process
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0004650Molecular Functionpolygalacturonase activity
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 586 aa     Download sequence    Send to blast
MLSEISGIHY LTTPEFQLPN PANFGNIIMQ DNLPNSFHFN EASVYSNLFQ TQIPPPGHDQ  60
LFATPMQSSS LSNNSSTSDE AEEQVQQLSN IIDQRKQRRM ISNRESARRS RMRKQKHLDE  120
LWSQVLRLRT ENHSLIDRLN HVSESHDKVL EENAKLKEEA SDLRQMLTEI QISTALRSTE  180
LETLSNVLNS GEDVEQDEEA WLVFVWSRWL CGKLGTLKGA VLQRTRCGGC AGASLYGHSP  240
RHPILDELVD GMKPQRVCAV ADGKFDNSEG TFMVAPVILQ RHCKGPMELQ VQGTLQAPVD  300
VQSSVGVDHW ITFRYVEHFV IHGGGLLDGQ GASAWGKSKA LPTDIRHITF LNSKNTHMKI  360
FTCNAVIISN INISAPGNSP NTDGIKVSNS NNTQISDSVI SAGDDCISFL PNSNNINITR  420
VHYGPGHGFS IGSISSGTVT NLNIRNSSLV GTQNGVRIKT KAHPSQPGNV AYITFEHIEM  480
DKVGNPIVID QNYCPGHGCS EKESSQVQIN NVNFNNIWGT SSTKTAVTFN CSRSKPCYEI  540
QLRDINLSKG GATMRCEGVP TPHPRHFSNP CNYVKPLEKG SPSVR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1bhe_A2e-1830654898362POLYGALACTURONASE
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1107114RRSRMRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLW9RBH84e-93W9RBH8_9R
STRINGPGSC0003DMT4000447172e-74(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30530.17e-40basic leucine-zipper 42