PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna04220.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family G2-like
Protein Properties Length: 295aa    MW: 32926.4 Da    PI: 10.1024
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna04220.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like82.73.9e-26180232355
                  G2-like   3 rlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                              r+ WtpeLH+rF++a++ LGG+e AtPk +++ m v+gLt+++vkSHLQk R+
  mrna04220.1-v1.0-hybrid 180 RRIWTPELHSRFMKAINDLGGAEAATPKLVKDRMRVDGLTNDQVKSHLQKLRI 232
                              899***********************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.137175235IPR017930Myb domain
SuperFamilySSF466895.38E-14176234IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.0E-23177234IPR009057Homeodomain-like
TIGRFAMsTIGR015575.6E-21180232IPR006447Myb domain, plants
PfamPF002491.6E-6183231IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MASTSNIVDL KLTLSLKPSW VPKSINNLLI EIAQINNASA KLSKLETYLR KHEEEMRRIQ  60
TFDRDHNLPH CMLLLKDAIE VIHEQISIIK NGKVEADHHT APLIWKNRNQ PEKPSFPPSK  120
HDWVSMVRPS KWSKKEEPEG TSTNLRPNFN INVNDCSTAS TPIVNNHVSP LPIEISRNGR  180
RIWTPELHSR FMKAINDLGG AEAATPKLVK DRMRVDGLTN DQVKSHLQKL RIYKRAGLPI  240
RQAGAGSSSA DVDSFHQPAA AMASQGNSTL QSQVPYTRDF FGIISSTSPA HDSN*
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna04220.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011467866.10.0PREDICTED: transcription repressor KAN1-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF148661012
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.12e-28G2-like family protein