PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna03865.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family G2-like
Protein Properties Length: 405aa    MW: 44216.3 Da    PI: 8.4056
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna03865.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like521.5e-162472772656
                  G2-like  26 kAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                               AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  mrna03865.1-v1.0-hybrid 247 AATPKQIRELMKVDGLTNDEVKSHLQKYRLH 277
                              69***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-14246280IPR009057Homeodomain-like
SuperFamilySSF466895.73E-7246280IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-13247277IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009001anatomyfruit
PO:0007010developmental stagewhole plant fruit ripening stage
PO:0007027developmental stagewhole plant fruit formation stage 70% to final size
Sequence ? help Back to Top
Protein Sequence    Length: 405 aa     Download sequence    Send to blast
MQGSKLGLYV KALEVEKQKI QVFQRELPLC LELVTQAIER CKQEISDNSI EYRHGQSECS  60
EQTSSEGHVF EEFIPLKRSS SSDSDDEELE ESDHLRNKNN DKDKSNSGDK KKSDWLRSVQ  120
LWNTTPDVPQ KEELPRKASV VEVKRNGGAF HPFQKEKSIG NTNGAVAKSP ASAPATSSTA  180
DTVSGGSGGG NSKKEDKEGQ RKQRRNCLEV HTVCYLKHFH VFEMNVAVSM IGCVSHMWLF  240
CLVFLAAATP KQIRELMKVD GLTNDEVKSH LQKYRLHTRR PTPTIHNNNN NNNSNAQAPQ  300
FVVVGGIWVP PQDYNAAVAA ANTASGEATR VAAAANGIYA PVASAPSAVT QVSPSTMHRP  360
RLKKPEPSSH SEERASHSSE VRGHSKSSAT SPSSTHTPAS PPVC*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in phosphate signaling in roots. {ECO:0000250|UniProtKB:Q9FX67}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00160DAPTransfer from AT1G25550Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna03865.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004297138.10.0PREDICTED: probable transcription factor GLK2
SwissprotQ9FPE81e-83HHO3_ARATH; Transcription factor HHO3
TrEMBLA0A2P6R1V10.0A0A2P6R1V1_ROSCH; Putative transcription factor MYB-HB-like family
STRINGXP_004297138.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF39183363
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25550.19e-64G2-like family protein
Publications ? help Back to Top
  1. Nagarajan VK,Satheesh V,Poling MD,Raghothama KG,Jain A
    Arabidopsis MYB-Related HHO2 Exerts a Regulatory Influence on a Subset of Root Traits and Genes Governing Phosphate Homeostasis.
    Plant Cell Physiol., 2016. 57(6): p. 1142-52
    [PMID:27016098]