PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna02646.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family HD-ZIP
Protein Properties Length: 254aa    MW: 28408.8 Da    PI: 7.8742
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna02646.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.97e-18104158256
                              T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                 Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                              rk+ ++tkeq  +Le+ F+++ +++ +++ eLA++l+L  rqV vWFqNrRa+ k
  mrna02646.1-v1.0-hybrid 104 RKKLRLTKEQSATLEDTFKQHTTLNPKQKLELARNLSLRPRQVEVWFQNRRARTK 158
                              78889************************************************98 PP

2HD-ZIP_I/II1215.9e-39104191188
              HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekevee 86 
                              +kk+rl+keq+++LE++F+++++L+p++K elar+L l+prqv+vWFqnrRARtk+kq+E d+e Lkr++++lkeen+rL+ke +e
  mrna02646.1-v1.0-hybrid 104 RKKLRLTKEQSATLEDTFKQHTTLNPKQKLELARNLSLRPRQVEVWFQNRRARTKLKQTEADCELLKRCCETLKEENRRLHKELQE 189
                              69************************************************************************************ PP

              HD-ZIP_I/II  87 Lr 88 
                              L+
  mrna02646.1-v1.0-hybrid 190 LQ 191
                              98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.5E-1792158IPR009057Homeodomain-like
SuperFamilySSF466891.5E-1895161IPR009057Homeodomain-like
PROSITE profilePS5007117.232100160IPR001356Homeobox domain
SMARTSM003897.4E-16102164IPR001356Homeobox domain
CDDcd000861.87E-15103161No hitNo description
PfamPF000461.9E-15104158IPR001356Homeobox domain
PROSITE patternPS000270135158IPR017970Homeobox, conserved site
PfamPF021831.3E-8160192IPR003106Leucine zipper, homeobox-associated
SMARTSM003401.4E-17160205IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009001anatomyfruit
PO:0007010developmental stagewhole plant fruit ripening stage
PO:0007027developmental stagewhole plant fruit formation stage 70% to final size
Sequence ? help Back to Top
Protein Sequence    Length: 254 aa     Download sequence    Send to blast
MGLDELGLSL GCHDKAANHD RDHHHQNQKK PHLKFDQLLP SDLTLGPSDE AGPRGSNSSS  60
PSGAISSFSN SSSFKRVDRD IPGSGEEVER VSEELYEDQA GSPRKKLRLT KEQSATLEDT  120
FKQHTTLNPK QKLELARNLS LRPRQVEVWF QNRRARTKLK QTEADCELLK RCCETLKEEN  180
RRLHKELQEL QLMKQTPTAP FYMQFPTATL TVCPSCSERI VNGSSAVAGD DHHLGVSKPH  240
HLLNPFTHPS TAC*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1152160RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna02646.1-v1.0-hybrid
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: In leaves by drought stress. {ECO:0000269|PubMed:17999151}.
UniProtINDUCTION: In leaves by drought stress. {ECO:0000269|PubMed:17999151}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004291006.10.0PREDICTED: homeobox-leucine zipper protein HOX19-like
SwissprotA2XE767e-65HOX19_ORYSI; Homeobox-leucine zipper protein HOX19
SwissprotQ8GRL47e-65HOX19_ORYSJ; Homeobox-leucine zipper protein HOX19
TrEMBLA0A2P6Q1371e-143A0A2P6Q137_ROSCH; Putative transcription factor Homobox-WOX family
STRINGXP_004291006.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF114433107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22800.11e-60HD-ZIP family protein