PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna02359.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family G2-like
Protein Properties Length: 260aa    MW: 29392.3 Da    PI: 7.1601
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna02359.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like96.81.6e-30165218255
                  G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                              pr+rWtp+LH++Fv+av++LGG+++AtPk+il++m+v+g+t++h+kSH Q YR+
  mrna02359.1-v1.0-hybrid 165 PRIRWTPDLHRCFVHAVDSLGGEDRATPKKILQIMNVEGVTINHIKSHVQTYRS 218
                              8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.609161221IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.3E-28162219IPR009057Homeodomain-like
SuperFamilySSF466891.18E-15164219IPR009057Homeodomain-like
TIGRFAMsTIGR015573.5E-24165219IPR006447Myb domain, plants
PfamPF002493.0E-7168217IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 260 aa     Download sequence    Send to blast
MAPRLRYSKP DSLHFPAALN LSVISTAMDA MFPPWDRSVS PLLGETLIYW LKCPSQDDLK  60
LSLEDDDKMS KGVTFSLFML FPPRYGNERV QLGEGSSVRR SVDNGQQLQL KDTPHFSSYE  120
NHETRNEPQQ VQVHRENLPA EMMILQRPTG PSTAMLPHVS SNRVPRIRWT PDLHRCFVHA  180
VDSLGGEDRA TPKKILQIMN VEGVTINHIK SHVQTYRSIK HEEHIQEAAA RANEYVREQT  240
PAESVNSSAT VVTSSWLHC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A9e-20166221459Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B9e-20166221459Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A9e-20166221459Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C9e-20166221459Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D9e-20166221459Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F9e-20166221459Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H9e-20166221459Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J9e-20166221459Protein PHOSPHATE STARVATION RESPONSE 1
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna02359.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A2P6Q2J47e-37A0A2P6Q2J4_ROSCH; Putative transcription factor MYB-HB-like family
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF93812840
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02060.18e-24G2-like family protein