PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna02284.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family bZIP
Protein Properties Length: 149aa    MW: 17187.2 Da    PI: 5.3397
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna02284.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_141.43.2e-131876361
                             XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1  3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61
                             ++k+ +++++NRe+ArrsR +K++ +eeL+ ++  L+  N +L++ ++   k +++l++
  mrna02284.1-v1.0-hybrid 18 DDKKRKKMESNRESARRSRMKKQKHVEELTVEITRLQISNNQLRQSIDAKDKAYSELEA 76
                             589*********************************************99999998875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.6E-121680IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.3581875IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.6E-101867No hitNo description
PfamPF001705.8E-111975IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.63E-102074No hitNo description
CDDcd147023.86E-162172No hitNo description
PROSITE patternPS0003602338IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006971Biological Processhypotonic response
GO:0009267Biological Processcellular response to starvation
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000693Biological Processpositive regulation of seed maturation
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
PO:0007134developmental stagesporophyte vegetative stage
Sequence ? help Back to Top
Protein Sequence    Length: 149 aa     Download sequence    Send to blast
MSSVQRQSSS GSDGCVVDDK KRKKMESNRE SARRSRMKKQ KHVEELTVEI TRLQISNNQL  60
RQSIDAKDKA YSELEAWNNV MRAQEKELTD RLRYLESIEQ TFVEFSGGFD ENMNGMAEMH  120
DTMLNPWQIP YSTQPITASS ADMFLDWP*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11923KKRKK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00419DAPTransfer from AT3G62420Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004300452.21e-106PREDICTED: ocs element-binding factor 1
SwissprotQ9LZP85e-37BZP53_ARATH; bZIP transcription factor 53
TrEMBLD9ZIR23e-52D9ZIR2_MALDO; BZIP domain class transcription factor
STRINGGLYMA03G37790.23e-39(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF42023460
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G62420.13e-34basic region/leucine zipper motif 53