PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna02177.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family bZIP
Protein Properties Length: 305aa    MW: 34175.7 Da    PI: 4.7953
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna02177.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_148.81.5e-15159218362
                              XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                              +++re+rkq+NRe+A+rsR R+++e+e+L+e ++ L +e ++L +el +l++e+ kl+ +
  mrna02177.1-v1.0-hybrid 159 RRRREKRKQSNRESAKRSRFRRQQECEKLRETAEMLNSEISELPNELRRLSEECGKLDEK 218
                              579******************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.6E-9154221IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.1E-11154217No hitNo description
PROSITE profilePS5021710.967159222IPR004827Basic-leucine zipper domain
PfamPF001703.1E-12159218IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.04E-8161212No hitNo description
CDDcd147024.94E-15162212No hitNo description
PROSITE patternPS000360164179IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MEIKEINNAS TQVVALEIQG KEEGILYDKD LEPMPPMPQS KEGSVDIDLV GNRVAESEKE  60
TSFSGNSGVS QSAAGRGEDS SDENADTNQD FSVLQKQMFN QIDQETAVQN NSRVLYSGTN  120
TDLNLLNIGV HMPETHLHLG MDLNVSSVHA IRTEEDHDRR RREKRKQSNR ESAKRSRFRR  180
QQECEKLRET AEMLNSEISE LPNELRRLSE ECGKLDEKTD EMEKMYGPDA VADLRAVKVN  240
SSDDGSNSIE SKPPRRDYST SPTPSHRNEI LPTPSHRIEA SPTPLEPRLF GVTLRPNSAD  300
CLRN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1157162DRRRRE
2158163RRRREK
3158166RRRREKRKQ
4159165RRREKRK
5159166RRREKRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004289625.11e-159PREDICTED: G-box-binding factor 1-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1575779
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36730.23e-16G-box binding factor 1