PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna01828.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family Trihelix
Protein Properties Length: 770aa    MW: 83546.7 Da    PI: 5.5769
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna01828.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix956.9e-3091175187
                 trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                              rW++qe+laL+++r+em+ ++r++ lk+plWe+vs+k++e g++r++k+Ckek+en++k+yk++keg+ +r++++s  +++f++le
  mrna01828.1-v1.0-hybrid  91 RWPRQETLALLKIRSEMDVAFRDATLKGPLWEDVSRKLAELGYKRNAKKCKEKFENVHKYYKRTKEGRAGRQDGKS--YKFFSELE 174
                              8*********************************************************************866665..******98 PP

                 trihelix  87 a 87 
                              a
  mrna01828.1-v1.0-hybrid 175 A 175
                              5 PP

2trihelix105.83.1e-33497582187
                 trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                              rW+k evlaLi++r+ +e+r++++  k+plWee+s+ m++ g++r+pk+Ckekwen+nk++kk+ke++k r +e+ +tcpyf++l+
  mrna01828.1-v1.0-hybrid 497 RWPKAEVLALIKLRSGLETRYQEAGPKGPLWEEISAGMQRMGYKRNPKRCKEKWENINKYFKKVKESNKVR-PEDAKTCPYFHELD 581
                              8********************************************************************97.99999********8 PP

                 trihelix  87 a 87 
                              a
  mrna01828.1-v1.0-hybrid 582 A 582
                              5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.006288150IPR001005SANT/Myb domain
PROSITE profilePS500906.58690148IPR017877Myb-like domain
CDDcd122032.33E-2890155No hitNo description
PfamPF138374.2E-2190176No hitNo description
PROSITE profilePS500906.946490554IPR017877Myb-like domain
SMARTSM007170.0065494556IPR001005SANT/Myb domain
CDDcd122031.62E-30496561No hitNo description
PfamPF138374.2E-23496583No hitNo description
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009001anatomyfruit
PO:0007010developmental stagewhole plant fruit ripening stage
PO:0007027developmental stagewhole plant fruit formation stage 70% to final size
Sequence ? help Back to Top
Protein Sequence    Length: 770 aa     Download sequence    Send to blast
MQGGGGGTQS HYGVVVSSAA EASTAAAPSM AAEAADQAHV VEEASPISSR PPAGGAISAV  60
NLDELMTLSG AAADVAADQG GGGGGGSGGN RWPRQETLAL LKIRSEMDVA FRDATLKGPL  120
WEDVSRKLAE LGYKRNAKKC KEKFENVHKY YKRTKEGRAG RQDGKSYKFF SELEALHGSP  180
SPNVSASPPV HVTTAAAAPV SIGFGSISNP MPISSFRMTG GNTSTVPIMS TQATGAIPIM  240
PSSQPPLPAS TAAPMDINFS SNSSSSSHGE DEDYEDDDEV AGEPPANTSR KRKRGTSSRE  300
SGGSTRRMME FFEILMKQVM QKQETMQQRF LEVIEKREQD RNIREEAWKR QEMARLTREH  360
ELMTQERAIS ASRDAAIIAF LQKITGQTIQ LPPPLNVHNA PPPPVPPSVS VHVTPVSAPP  420
PPLAQQQSLH QVHQHQPQQQ TPPTQISRHQ IRTSIPPTPS ANQTEVVMAV PEQQVAQSQE  480
IVVGSGGGFE ATTSSSRWPK AEVLALIKLR SGLETRYQEA GPKGPLWEEI SAGMQRMGYK  540
RNPKRCKEKW ENINKYFKKV KESNKVRPED AKTCPYFHEL DALYRKRILG GGPSGGSSSS  600
LGNQTVQQQP QQAPPQPKLD SAAQGTVANT QQTQGTVAAT DQSVNKSGDD SPNLQKNLFG  660
DAPEEAAKKP EDIVKELMGQ QQQHHHQVLN QQGVQQQLVV EDYDRVEEGD SDVNLDQDEE  720
EDEEDEEDEE MDDESRKMDY KIEFQKQQNT GPSSNGGGNG APSFLAMVQ*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1133141KRNAKKCKE
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna01828.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004309494.10.0PREDICTED: trihelix transcription factor GTL1 isoform X1
TrEMBLA0A2H4NFV40.0A0A2H4NFV4_FRAAN; Trihelix transcription factor GT-2F
STRINGXP_004309494.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF37334181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.11e-48Trihelix family protein