PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna01680.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family bZIP
Protein Properties Length: 586aa    MW: 64330.9 Da    PI: 6.3111
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna01680.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.76.7e-10421473557
                              CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                              kr++r   NR +A rs +RK  +i eLe kv++L++e ++L  +l  l+  + 
  mrna01680.1-v1.0-hybrid 421 KRAKRILANRQSAARSKERKMRYISELEHKVQTLQTEATTLSAQLTLLQRDSV 473
                              9******************************************9999987665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003387.4E-17417481IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.714419482IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1705.9E-9421477No hitNo description
PfamPF001707.9E-9421475IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.46E-11421472No hitNo description
CDDcd147032.72E-24422471No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 586 aa     Download sequence    Send to blast
MGDTEEGNSD MMQRLQSSFG TSSSSILKQP LSMDQLNIPQ FSSSQMRSRH FAQSFTGDTS  60
KRMGIPPSHP NHIPPLSPYS QIPVARPINQ TMGSQNFSPG PSHSRSLSQP AFFSLDSLPP  120
LSPSPYRDSP STSMSEVDVS MEDRDASSHS LLPPSPFGRA NFSRVGESLP PRKAHRRSNS  180
DIPFGFSTMM QQALPPIAPM RGSGSVDLSM SGTENSGMVK PAQLVKKESS WERAGDNNVE  240
GTGERKSEGE VVDDLFSAYM NLDSIDALNS SGTDDKNGNE NREDMDSSRA SGTKTNCDSS  300
DNEVESSVNE SGGMQRPGLN SLTNMREGIK RSAGGDIAPT TRHFRSVSMD SFMGKLQFGD  360
ESPKLPPSPG TRPGQLSPSN SIDTNSNAFS LEFGNGEFSG AEMKKIMANE KLAEIALTDP  420
KRAKRILANR QSAARSKERK MRYISELEHK VQTLQTEATT LSAQLTLLQR DSVGLSNQNN  480
ELKFRLQAME QQAQLRDALN EALTSEVQRL KLATTDLNGE SHPSKSMINA QRFQLQQQSP  540
QTQFNIHQQQ QQQQQQQQQQ QQQQHQTPQQ LQENGTTTSK PESDQ*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004290316.10.0PREDICTED: transcription factor RF2a
TrEMBLA0A067K7430.0A0A067K743_JATCU; Uncharacterized protein
STRINGVIT_03s0038g00860.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF22723484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.31e-172bZIP family protein