PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna01638.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family GATA
Protein Properties Length: 354aa    MW: 39217.7 Da    PI: 4.8799
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna01638.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA58.31e-18272305134
                     GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                              Cs+C++ kTp+WR gp g+ktLCnaCG++y++ +
  mrna01638.1-v1.0-hybrid 272 CSHCQVQKTPQWRTGPLGPKTLCNACGVRYKSGR 305
                              *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169921.9E-805350IPR016679Transcription factor, GATA, plant
PROSITE profilePS5011411.398266302IPR000679Zinc finger, GATA-type
SMARTSM004019.6E-15266320IPR000679Zinc finger, GATA-type
SuperFamilySSF577164.37E-14269329No hitNo description
Gene3DG3DSA:3.30.50.101.7E-14270303IPR013088Zinc finger, NHR/GATA-type
CDDcd002026.54E-14271320No hitNo description
PROSITE patternPS003440272297IPR000679Zinc finger, GATA-type
PfamPF003201.8E-16272305IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
PO:0007134developmental stagesporophyte vegetative stage
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MELCMEARAL KSSLRRELAM KSTQHALMEE LWCATAISGV PSEDFSVDDL LDFSNSQFEN  60
GSVEEEQELE EHEEEEEEEE EEEEDKDSVS VDSVENSNSS YFTTESTLAS QLAVPDDDIA  120
ELEWVSHFVD DSASELSLLH PVSKLKPEAL TLNRSEPEAR RLALAHDQST LSWLPSQVPV  180
KPRSKRFRPA SRLRSSVWNP LGDSPSLTSS LPSPSSTSSC SSGMSFSTPC LVLTNPVHKV  240
GVFWGEPAAK KQKRKPAVQT GDEVVVGTQR RCSHCQVQKT PQWRTGPLGP KTLCNACGVR  300
YKSGRLFPEY RPACSPTFSG DVHSNSHRKV LEMRRRKDTG EPESGMSKMI PGF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004290341.10.0PREDICTED: GATA transcription factor 5-like
TrEMBLD9ZIZ01e-133D9ZIZ0_MALDO; GATA domain class transcription factor
STRINGPOPTR_0004s16860.13e-95(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.21e-53GATA transcription factor 5