PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna01338.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family SBP
Protein Properties Length: 381aa    MW: 42622.9 Da    PI: 8.987
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna01338.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP127.55.2e-4099176178
                              --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                      SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                              +C v+gC+adls+++eyhrrh+vCe hsk+p v+++g+++rfCqqCsrfh+l efDe krsCr+rL++hn+rrrk+++
  mrna01338.1-v1.0-hybrid  99 TCLVDGCKADLSRCREYHRRHRVCELHSKTPIVVIRGQQKRFCQQCSRFHSLVEFDEVKRSCRKRLNGHNQRRRKPKP 176
                              5**************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.7E-3193161IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.5397174IPR004333Transcription factor, SBP-box
SuperFamilySSF1036125.36E-3798179IPR004333Transcription factor, SBP-box
PfamPF031101.8E-29100173IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
PO:0007134developmental stagesporophyte vegetative stage
Sequence ? help Back to Top
Protein Sequence    Length: 381 aa     Download sequence    Send to blast
MEWDYKDFAW DSTDDDQLDQ PLEENDLAAL VGSSSIIRGG ESSSSFNLVD LKLGSTTSAE  60
VVAPIATKPS VLVSSSSLSR TRRVDHHQKL KVSSSSTATC LVDGCKADLS RCREYHRRHR  120
VCELHSKTPI VVIRGQQKRF CQQCSRFHSL VEFDEVKRSC RKRLNGHNQR RRKPKPESFY  180
FTSKNFLSNF KGPRILHFGN PQLCATTNVR SLWPFEAKNT ADHQPMLYNR HQRLQAVDHL  240
RTPPNSFTNN EGADKQFIFL QTNDSKRSAF NQAAIPQAFM QEPFPTLTAA AALPPSTRAA  300
AGSAISFDGT TRSIDPSCAL YLLSSPNPTH SLVNTSLSHM VQPNVVTSTD SGHQQLQMKS  360
FFELPSYSLN NHVEDKYCLS *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-2793173484squamosa promoter binding protein-like 4
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna01338.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004304529.10.0PREDICTED: squamosa promoter-binding-like protein 13A
TrEMBLA0A2P6S6I10.0A0A2P6S6I1_ROSCH; Putative transcription factor SBP family
STRINGXP_004304529.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF100312640
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.16e-45SBP family protein