PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna01286.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family LBD
Protein Properties Length: 287aa    MW: 32043.7 Da    PI: 6.0833
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna01286.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260126.31.4e-39101091100
                   DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqq 86 
                              aCaaCk++rr+C+kdC lap+fpa+q k+f+n+h+l+G+sn++k+lk++ + ++e+am+s++ye+++ra+ Pv G++g+i++l+ q
  mrna01286.1-v1.0-hybrid  10 ACAACKYQRRRCTKDCELAPHFPADQLKQFQNAHRLYGVSNIMKVLKQTGPGKKEEAMRSIIYESNMRAKFPVTGCMGIINQLTFQ 95 
                              7************************************************************************************* PP

                   DUF260  87 leqlkaelallkee 100
                              l+q+ +el +++++
  mrna01286.1-v1.0-hybrid  96 LQQAYEELRYVRSH 109
                              ********999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.3219110IPR004883Lateral organ boundaries, LOB
PfamPF031954.6E-3710107IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MTIKGGTSQA CAACKYQRRR CTKDCELAPH FPADQLKQFQ NAHRLYGVSN IMKVLKQTGP  60
GKKEEAMRSI IYESNMRAKF PVTGCMGIIN QLTFQLQQAY EELRYVRSHL AICRDQCQYQ  120
YNSPTCPSSQ LQLGLQTNDH EALQLYQQQY QYHQYNSAAG SSGGGGGGMS EYLANGINGL  180
YIDENDSVVK PLRVQQFYYG NNNVDAVAVQ HNLMTSQGFP IQQEMDVPHD YDDIPFDTIA  240
DDRQSYIESK EACESSAESA FKGTQSLEHV SQNDLKSAAA FFSLTS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-2361107111LOB family transfactor Ramosa2.1
5ly0_B1e-2361107111LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna01286.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011466249.10.0PREDICTED: LOB domain-containing protein 27-like
TrEMBLA0A2P6S4T11e-176A0A2P6S4T1_ROSCH; Putative transcription factor AS2-LOB family
STRINGXP_004302364.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44152958
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.11e-40LOB domain-containing protein 27