PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna00600.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family G2-like
Protein Properties Length: 307aa    MW: 34100.1 Da    PI: 8.1125
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna00600.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.42.9e-322275255
                  G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                             prlrWtpeLH++Fv+a+e+LGG++kAtPk +l++m+vkgLt++hvkSHLQ++R+
  mrna00600.1-v1.0-hybrid 22 PRLRWTPELHHCFVQAIERLGGHKKATPKLVLQIMDVKGLTISHVKSHLQMFRS 75
                             8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.1951878IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.8E-301876IPR009057Homeodomain-like
SuperFamilySSF466893.58E-152075IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-232275IPR006447Myb domain, plants
PfamPF002496.2E-82373IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MSTSSSCGRN GAVRPYIRSK VPRLRWTPEL HHCFVQAIER LGGHKKATPK LVLQIMDVKG  60
LTISHVKSHL QMFRSMRGGD LSRAPDESLT HQRKQSFEEH SDGCLDHEVN VMGFLSASKP  120
IPESDPQVIY SVPRRSKPIT ESDPQAIYTD PSHSKRARIE TTSCSISERQ QQWSQTTHET  180
APYSYDHYGL VLANGVSLSQ PQHYLYNFNN PFLKSAFQES DFFKIDEKHE AKLHKQENTG  240
RAHKEGGDCQ LSLSLSLHHP SSNTSIASSS EDIGGAISGF NYKDCSTFSS ANRGVDLNLS  300
IALCGN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-182377458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-182377458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A1e-182377357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-182377357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-182377357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-182377357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-182377458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-182377458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-182377458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-182377458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-182377458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-182377458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna00600.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004297794.10.0PREDICTED: putative Myb family transcription factor At1g14600
TrEMBLA0A2P6R4F10.0A0A2P6R4F1_ROSCH; Putative transcription factor MYB-HB-like family
STRINGXP_004297794.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF55393353
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14600.11e-32G2-like family protein