PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna00537.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family HB-other
Protein Properties Length: 559aa    MW: 62016.9 Da    PI: 7.63
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna00537.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.17.1e-092783102355
                              SS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
                 Homeobox  23 rypsaeereeLAkklgLterqVkvWFqNrRake 55 
                              +yps+ ++  LA+++gLt +q+ +WF N+R ++
  mrna00537.1-v1.0-hybrid 278 PYPSEPQKLALAASTGLTVKQINNWFINQRKRH 310
                              8*****************************885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012558.9E-1691135IPR005540KNOX1
PfamPF037908.4E-1993131IPR005540KNOX1
SMARTSM012562.7E-21143194IPR005541KNOX2
PfamPF037912.7E-19149192IPR005541KNOX2
PROSITE profilePS512138.94230250IPR005539ELK domain
PROSITE profilePS5007112.714250313IPR001356Homeobox domain
SuperFamilySSF466891.41E-18251319IPR009057Homeodomain-like
SMARTSM003899.3E-13252317IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.5E-26255316IPR009057Homeodomain-like
CDDcd000861.69E-12262314No hitNo description
PfamPF059201.1E-15270309IPR008422Homeobox KN domain
PROSITE patternPS000270288311IPR017970Homeobox, conserved site
PROSITE profilePS5103823.853372487IPR001025Bromo adjacent homology (BAH) domain
SMARTSM004391.8E-41372487IPR001025Bromo adjacent homology (BAH) domain
CDDcd047141.69E-56374507No hitNo description
PfamPF014261.6E-23374486IPR001025Bromo adjacent homology (BAH) domain
SuperFamilySSF579031.55E-7482513IPR011011Zinc finger, FYVE/PHD-type
Gene3DG3DSA:3.30.40.101.6E-6487513IPR013083Zinc finger, RING/FYVE/PHD-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003682Molecular Functionchromatin binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 559 aa     Download sequence    Send to blast
MESERWSRVP KGRETEKMES GMGKSNYYYS HGVMGSAGSS SGMLMPPPLV NSYAAAAADQ  60
TSSSSNHQHC FVSLPFTNIN PNQNGSQEYE MRMKTKVMSH PLFPRLLASY VNCQKVGAPA  120
EVVARLEDAA AASISSSAAL SAACEESEPD PELDQFMEAY CEMLTKYHEE LTKPFHEAML  180
GLSKINSQLK ALSVSPSYSA STGDLVGQGG SSEEAGVNEN CIDPRAKDWD IRAKLLQKYG  240
GSLGSLSQEL KKKKKNGKLP KEARVQLQEW WSRNYTWPYP SEPQKLALAA STGLTVKQIN  300
NWFINQRKRH WKPSAEGQVG ENGGEVMGAR LAIKFGCGGC NEVGSSSTTT FMAKTKPGKK  360
DLDSYNIKGT NKAVRVGDCV LMRPSDTDKP PYVARVEKLE ADHRNNVKVR VRWYYRPEES  420
IGGRRQFHGA KELFLSDHFD VQSAHTIEGK CTVHSFKNYT KLENVGAEDY FCRFEYKAAT  480
GGFTPDRVAV YCKCEMPYNP DDLMVQCEGC KDWNVYPEAF LNEWLSRIEN GTLTSSAHLL  540
ELHITLKELE ASNKCNVA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ4137760.0HQ413776.1 Fragaria vesca knotted-like homeobox KNOX3 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001267003.10.0homeobox protein SBH1-like
TrEMBLF5A6B30.0F5A6B3_FRAVE; Knotted-like homeobox KNOX3
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20393480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.12e-65KNOX/ELK homeobox transcription factor