PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00004677.1.g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family NAC
Protein Properties Length: 355aa    MW: 40161 Da    PI: 7.7045
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00004677.1.g00001.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM102.74.8e-3298255129
                             NAM  55 ekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                                     ++ewyfFs++d+ky+tg+r+nrat++g+Wkatg+dk + + + +++g++ktLvfy+grap+g+ktdW+mheyrle
  FANhyb_rscf00004677.1.g00001.1   9 QNEWYFFSHKDRKYPTGSRTNRATNAGFWKATGRDKCIRN-TYKKIGMRKTLVFYRGRAPHGQKTDWIMHEYRLE 82 
                                     67*************************************9.8999****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100539.691105IPR003441NAC domain
SuperFamilySSF1019413.79E-378105IPR003441NAC domain
PfamPF023651.7E-15881IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048829Biological Processroot cap development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
RCRIGSTPQN EWYFFSHKDR KYPTGSRTNR ATNAGFWKAT GRDKCIRNTY KKIGMRKTLV  60
FYRGRAPHGQ KTDWIMHEYR LEDGDDPQGN LSSEDGWVIC RVFKKKNLFK VTGNNEGGSS  120
SMNSSDHHHH QQLTMNTNQL QARTFMHAHS SRSDNQYLLR QQAFELNRPH DHDQDQDQLP  180
PSLHYAHLNL QPPPQYSLFH SQALNIPTTN SHKTLAAYND YSALPSDSSP GHGMVKQLMT  240
NPRDCESTGS ESLRYQACEP GLEVNDSACE PNQQTMVNAG GRSSDDQGMS EWAMLDRLVT  300
SHLGNEDSTS KGGASPSARY DQDGSGSSTV NQINQQQQQQ QLSLRGEMDF WGYAK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-32910770167NO APICAL MERISTEM PROTEIN
1ut4_B2e-32910770167NO APICAL MERISTEM PROTEIN
1ut7_A2e-32910770167NO APICAL MERISTEM PROTEIN
1ut7_B2e-32910770167NO APICAL MERISTEM PROTEIN
3swm_A2e-32910773170NAC domain-containing protein 19
3swm_B2e-32910773170NAC domain-containing protein 19
3swm_C2e-32910773170NAC domain-containing protein 19
3swm_D2e-32910773170NAC domain-containing protein 19
3swp_A2e-32910773170NAC domain-containing protein 19
3swp_B2e-32910773170NAC domain-containing protein 19
3swp_C2e-32910773170NAC domain-containing protein 19
3swp_D2e-32910773170NAC domain-containing protein 19
4dul_A2e-32910770167NAC domain-containing protein 19
4dul_B2e-32910770167NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator. Together with BRN1 and SMB, regulates cellular maturation of root cap. Promotes the expression of genes involved in secondary cell walls (SCW) biosynthesis. {ECO:0000269|PubMed:20197506}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00431DAPTransfer from AT4G10350Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004292409.10.0PREDICTED: protein BEARSKIN1
SwissprotQ9SV871e-106BRN2_ARATH; Protein BEARSKIN2
TrEMBLA0A2P6PKB90.0A0A2P6PKB9_ROSCH; Putative transcription factor NAM family
STRINGXP_004292409.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF87523343
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G10350.12e-98NAC domain containing protein 70
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Kamiya M, et al.
    Control of root cap maturation and cell detachment by BEARSKIN transcription factors in Arabidopsis.
    Development, 2016. 143(21): p. 4063-4072
    [PMID:27803060]