PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00004597.1.g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family NAC
Protein Properties Length: 401aa    MW: 46132.2 Da    PI: 6.4598
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00004597.1.g00001.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM164.24.6e-51171451128
                             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka...eekewyfFskrdkkyatgkrknr 76 
                                     +ppGfrFhPt+eel+++yL+kkv+ ++++l +vi+evd++k+ePwd+++k+k     +++wyfFs++dkky+tg+r+nr
  FANhyb_rscf00004597.1.g00001.1  17 VPPGFRFHPTEEELLHYYLRKKVAYERIDL-DVIREVDLNKLEPWDIQEKCKIgstPQNDWYFFSHKDKKYPTGTRTNR 94 
                                     69****************************.9***************964444222455******************** PP

                             NAM  77 atksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                     at++g+Wkatg+dk ++s + + +gl+ktLvfykgrap+g+k+dW+mheyrl
  FANhyb_rscf00004597.1.g00001.1  95 ATAAGFWKATGRDKIIYS-GIRRIGLRKTLVFYKGRAPHGQKSDWIMHEYRL 145
                                     ******************.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.7E-5710177IPR003441NAC domain
PROSITE profilePS5100556.59617177IPR003441NAC domain
PfamPF023658.5E-2718145IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 401 aa     Download sequence    Send to blast
MSAEDQMNLS INGQSQVPPG FRFHPTEEEL LHYYLRKKVA YERIDLDVIR EVDLNKLEPW  60
DIQEKCKIGS TPQNDWYFFS HKDKKYPTGT RTNRATAAGF WKATGRDKII YSGIRRIGLR  120
KTLVFYKGRA PHGQKSDWIM HEYRLDDSSS SLDTTVSNSI GESMAEDGWV VCRVFKKKNY  180
QKAMESPKVS FSMDSQNNQM LPGSRNDGVL DQILLYMGRN TCKIENHDSL HHERFMHLPR  240
LESQTSLPSL PVQFDHNRSF KACYHDQTID DMLIETDQQQ QQQQPSPTNQ SNNPVHDQHD  300
HDDPKTRIVN DWATLDRLVA SQLNGHEDET SKHLSCFGDP NMAFCSSSPS NDGDLQLPYP  360
YLRQGRISQN QPEVFNSEND LWSFTKSSPS PSSSDPLCHL S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-5031799170Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator of genes involved in biosynthesis of secondary walls. Together with NST2 and NST3, required for the secondary cell wall thickening of sclerenchymatous fibers, secondary xylem (tracheary elements), and of the anther endocethium, which is necessary for anther dehiscence. May also regulate the secondary cell wall lignification of other tissues. {ECO:0000269|PubMed:16214898, ECO:0000269|PubMed:17237351, ECO:0000269|PubMed:17333250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004309531.10.0PREDICTED: NAC domain-containing protein 43-like
SwissprotQ84WP61e-117NAC43_ARATH; NAC domain-containing protein 43
TrEMBLA0A2P6P4A20.0A0A2P6P4A2_ROSCH; Putative transcription factor NAM family
STRINGXP_004309531.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF30313374
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46770.11e-104NAC family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Gondolf VM, et al.
    A gene stacking approach leads to engineered plants with highly increased galactan levels in Arabidopsis.
    BMC Plant Biol., 2014. 14: p. 344
    [PMID:25492673]
  3. Jaradat MR,Ruegger M,Bowling A,Butler H,Cutler AJ
    A comprehensive transcriptome analysis of silique development and dehiscence in Arabidopsis and Brassica integrating genotypic, interspecies and developmental comparisons.
    GM Crops Food, 2014. 5(4): p. 302-20
    [PMID:25523176]
  4. Yuan Y,Teng Q,Zhong R,Ye ZH
    TBL3 and TBL31, Two Arabidopsis DUF231 Domain Proteins, are Required for 3-O-Monoacetylation of Xylan.
    Plant Cell Physiol., 2016. 57(1): p. 35-45
    [PMID:26556650]
  5. Yang C, et al.
    Transcription Factor MYB26 Is Key to Spatial Specificity in Anther Secondary Thickening Formation.
    Plant Physiol., 2017. 175(1): p. 333-350
    [PMID:28724622]
  6. Pascual MB, et al.
    PpNAC1, a main regulator of phenylalanine biosynthesis and utilization in maritime pine.
    Plant Biotechnol. J., 2018. 16(5): p. 1094-1104
    [PMID:29055073]
  7. Liu C,Yu H,Li L
    SUMO modification of LBD30 by SIZ1 regulates secondary cell wall formation in Arabidopsis thaliana.
    PLoS Genet., 2019. 15(1): p. e1007928
    [PMID:30657769]