PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00004461.1.g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family ERF
Protein Properties Length: 134aa    MW: 14481.7 Da    PI: 4.6514
Description ERF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00004461.1.g00001.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1AP242.31.8e-1315571256
                             AP2 12 rgrWvAeIrdpsengkrkrfslgkfgtaeeAakaaiaarkklege 56
                                     g++ AeIrdps ng  +r +lg+f taeeAa+a+++a+  ++g+
  FANhyb_rscf00004461.1.g00001.1 15 GGKYGAEIRDPSRNG--ARLWLGTFETAEEAARAYDRAAFGFRGH 57
                                    599*******98887..**********************988886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5103219.638164IPR001471AP2/ERF domain
SuperFamilySSF541714.05E-181165IPR016177DNA-binding domain
SMARTSM003801.5E-221471IPR001471AP2/ERF domain
PfamPF008474.7E-71557IPR001471AP2/ERF domain
CDDcd000181.04E-211665No hitNo description
Gene3DG3DSA:3.30.730.104.0E-231666IPR001471AP2/ERF domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 134 aa     Download sequence    Send to blast
MEGERAEEGF GSGRGGKYGA EIRDPSRNGA RLWLGTFETA EEAARAYDRA AFGFRGHLAI  60
LNFPNEYQYH NPSTSASSFV ASHSVSSSSS TSSTSVSSAP AGGGMQFGNE EGRLIEFEYL  120
DNMVLEELLE GQRK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gcc_A2e-2016641260ETHYLENE RESPONSIVE ELEMENT BINDING FACTOR 1
2gcc_A2e-2016641563ATERF1
3gcc_A2e-2016641563ATERF1
5wx9_A3e-2016672475Ethylene-responsive transcription factor ERF096
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbably acts as a transcriptional activator. Binds to the GCC-box pathogenesis-related promoter element. May be involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways (By similarity). {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011457997.18e-58PREDICTED: ethylene-responsive transcription factor ERF098-like
SwissprotQ9LTC51e-34ERF98_ARATH; Ethylene-responsive transcription factor ERF098
TrEMBLA0A3Q8TEE31e-59A0A3Q8TEE3_FRAAN; Transcription factor ERF77
STRINGXP_004292209.11e-57(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF27033215
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23230.12e-21ERF family protein
Publications ? help Back to Top
  1. Van den Broeck L, et al.
    From network to phenotype: the dynamic wiring of an Arabidopsis transcriptional network induced by osmotic stress.
    Mol. Syst. Biol., 2017. 13(12): p. 961
    [PMID:29269383]