PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00004108.1.g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family NAC
Protein Properties Length: 374aa    MW: 43181.3 Da    PI: 6.7916
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00004108.1.g00001.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1341e-41331391106
                             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknr 76 
                                     +ppGfrFhPtdeelv++yL+kk+++kk++l +vi++vd+yk+ePwdL++  k+ + +++ewyfFs++dkky+tg+r+nr
  FANhyb_rscf00004108.1.g00001.1  33 VPPGFRFHPTDEELVDYYLRKKIASKKIDL-DVIRDVDLYKIEPWDLQElcKIGSeDQNEWYFFSHKDKKYPTGTRTNR 110
                                     69****************************.9***************954555552455******************** PP

                             NAM  77 atksgyWkatgkdkevlskkgelvglkktL 106
                                     atk+g+Wkatg+dk+++  +++lvg++ktL
  FANhyb_rscf00004108.1.g00001.1 111 ATKAGFWKATGRDKAIYI-RHNLVGMRKTL 139
                                     ******************.899*******9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.31E-4330151IPR003441NAC domain
PROSITE profilePS5100537.07933193IPR003441NAC domain
PfamPF023653.7E-1934140IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 374 aa     Download sequence    Send to blast
MHVYPHNLHP VLKCPLTLLG GVGLKNMNTF SHVPPGFRFH PTDEELVDYY LRKKIASKKI  60
DLDVIRDVDL YKIEPWDLQE LCKIGSEDQN EWYFFSHKDK KYPTGTRTNR ATKAGFWKAT  120
GRDKAIYIRH NLVGMRKTLE EGWVVCRVFK KRLATVRRMG DYESSCWYDQ SSSFMPELDS  180
PRTNMIPNPA YTTTSSSSSY HQQLYSNCKQ ELDHHLQYNA MPVPPHPDSF LQLPQLESPR  240
VAQYGTYDHH HHRNNGCHVM PSSTFRPEEQ VQQMNQQNLM INSSPLLYND NSLDDQLTDW  300
RVLDKFVASQ LSHDQQEASK ETTANYSNEA VFDPVGDEVH TSMGANESKR PENIIAQDYA  360
ASTSTSSCQI DLWK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A5e-333213914118Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:16103214, PubMed:25148240). {ECO:0000250|UniProtKB:Q9LVA1, ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:25148240}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004298666.10.0PREDICTED: NAC domain-containing protein 7
SwissprotQ9FWX21e-115NAC7_ARATH; NAC domain-containing protein 7
TrEMBLA0A251P5561e-141A0A251P556_PRUPE; Uncharacterized protein
STRINGXP_004298666.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF126933106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G12260.11e-116NAC 007
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Heyndrickx KS,Vandepoele K
    Systematic identification of functional plant modules through the integration of complementary data sources.
    Plant Physiol., 2012. 159(3): p. 884-901
    [PMID:22589469]