PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00004051.1.g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family NAC
Protein Properties Length: 312aa    MW: 35095.4 Da    PI: 5.2344
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00004051.1.g00002.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM58.13e-18141178128
                             NAM   8 hPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                                     h td+el   +L+k ++g++l+  +vi++v+ y++ P+ Lp          +++  r+++       ++ t+ gyW+ t
  FANhyb_rscf00004051.1.g00002.1  14 HYTDKELC-MFLQKLLSGSPLPK-NVIDDVNPYQYMPSYLP-----P--GSFWYLIRSNE-------SKDTNLGYWRPT 76 
                                     559***98.9**********999.99**************9.....2..34555554443.......345789****** PP

                             NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                      +  ++++ ++  +g ++tL fy+grap+ +kt+W m+eyr+
  FANhyb_rscf00004051.1.g00002.1  77 EEACKIFT-DSVITGWRNTLEFYEGRAPHEHKTNWRMQEYRI 117
                                     ********.999****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-237137IPR003441NAC domain
PROSITE profilePS5100524.2967140IPR003441NAC domain
PfamPF023652.1E-914117IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MHPQAVLPAD IGVHYTDKEL CMFLQKLLSG SPLPKNVIDD VNPYQYMPSY LPPGSFWYLI  60
RSNESKDTNL GYWRPTEEAC KIFTDSVITG WRNTLEFYEG RAPHEHKTNW RMQEYRITYH  120
KVSENSKTKE ANLLCRVQSV SAERKNPIAN RFSQPVVSLA ETLTGHASTS KPQVIKDTET  180
GTLTVTERLP DHQVAIMPEI EIDFPFGDDY IELLDLDRPA SFSSSSNSSC LTMSSDECFD  240
SLALLEELEP IASQDQANKN AGCRYSISVS QKPDELVMYA AASSSGSLSK SPNEEKVKSH  300
SLRFPVQQSA LR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004291902.10.0PREDICTED: NAC domain-containing protein 74-like
RefseqXP_011459571.10.0PREDICTED: NAC domain-containing protein 74-like
TrEMBLA0A2P6PYK51e-167A0A2P6PYK5_ROSCH; Putative transcription factor NAM family
STRINGXP_004291902.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF105882235
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G46590.12e-17NAC domain containing protein 96