PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00003915.1.g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family SBP
Protein Properties Length: 688aa    MW: 75870.7 Da    PI: 7.6693
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00003915.1.g00001.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP1291.7e-40238315178
                                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                                     +Cqv++C++dls+ak+yhrrhkvCe h+k++++lv++++qrfCqqCsrfh lsefDe+krsCrrrLa+hn+rrrk+q+
  FANhyb_rscf00003915.1.g00001.1 238 MCQVDDCKEDLSTAKDYHRRHKVCESHAKSTKALVAKQMQRFCQQCSRFHPLSEFDEGKRSCRRRLAGHNRRRRKTQP 315
                                     6**************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.4E-34232300IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.573236313IPR004333Transcription factor, SBP-box
SuperFamilySSF1036128.76E-37237317IPR004333Transcription factor, SBP-box
PfamPF031106.1E-30239312IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042742Biological Processdefense response to bacterium
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 688 aa     Download sequence    Send to blast
SSFWSSSSSS SSINSGSVTE EHEAVCWVLL CVELGESVRF GILIVGQICI ADWSLRGSDR  60
ETKQGSRIDW EFHVWVQLKI ILVSESWMEE VGAQVATPIF LRQSLSSRFC DPPAAMAKKK  120
RDLPYQAPNY QHPNSQPLFG NPGSNSWNPN VWDWDAVRFV ARPLDTEMMG ASNSEPRRKE  180
EAAGGAVKST AVAVEDEDER LQLNLGGGLA SVEEPAVSRP NKRVRSGSPG NNGGSYPMCQ  240
VDDCKEDLST AKDYHRRHKV CESHAKSTKA LVAKQMQRFC QQCSRFHPLS EFDEGKRSCR  300
RRLAGHNRRR RKTQPEDVTS RLTIPGDGDN KTSGNLDIVS LLAAITRPQG KTDVRNTNSS  360
SVLDREQLLQ ILSKINSLPL PVDLAAKLPN LGNLNWKASD LLPLDLQNKL NGKTSVSTLD  420
LITVLSATLA TPSDTLAILS QKSSQSSDSE KTKLTCSDQE RPNLQKRSPQ EFHSAGGERS  480
STSYQSPAED SDCQVQETRV KLPLQLFSSS PEDDSPPKLA SSRKYFSSDS SNRTEERSPS  540
SSPPVMQTLF PMKSLAETVK SEKRSISKES NLNLDYSLNG GSNLPFDLFR GSNRGAVSSS  600
IQNFPHQAGY TSSGSDHSPS SLNSDPQDRT GRILFKLFDK DPSQLPGTLR TQVYSWLSNS  660
PSEMESHIRP GCVVLSVYVS MPFAAWEH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A9e-31227312184squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May play a role in plant development. {ECO:0000250, ECO:0000269|PubMed:15703061}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00155DAPTransfer from AT1G20980Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004300082.10.0PREDICTED: squamosa promoter-binding-like protein 14
SwissprotQ8RY950.0SPL14_ARATH; Squamosa promoter-binding-like protein 14
TrEMBLA0A2P6PC020.0A0A2P6PC02_ROSCH; Putative transcription factor SBP family
STRINGXP_004300082.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96943139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20980.11e-168squamosa promoter binding protein-like 14
Publications ? help Back to Top
  1. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  2. Liu J, et al.
    Characterizing Variation of Branch Angle and Genome-Wide Association Mapping in Rapeseed (Brassica napus L.).
    Front Plant Sci, 2016. 7: p. 21
    [PMID:26870051]