PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00003491.1.g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family TCP
Protein Properties Length: 351aa    MW: 39151.1 Da    PI: 8.9351
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00003491.1.g00001.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP127.41.4e-391172392133
                             TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaessss 80 
                                     a+kkdrhski T++g RdRRvRls+++a++fFdLqd LGfdk+s t+eWLl ++k ai +l +++ +++ ++   ss s
  FANhyb_rscf00003491.1.g00001.1 117 AVKKDRHSKIFTAQGFRDRRVRLSLNVAREFFDLQDLLGFDKASTTLEWLLGKSKNAIRDLEKSKCKNSFSS---SSTS 192
                                     78**************************************************************44433111...1111 PP

                             TCP  81 sasnsssgkaaksaa.kskksqksaasalnlakesrakarararertrekmrik 133
                                     +      +   +++  k+ ++ k+aa    +a++srakarararertrekm+  
  FANhyb_rscf00003491.1.g00001.1 193 E-----CDGVLEDNLdKRMRKMKEAA--AIMARSSRAKARARARERTREKMCRI 239
                                     1.....11222223324455555555..88888******************965 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036344.7E-33118237IPR005333Transcription factor, TCP
PROSITE profilePS5136931.306119177IPR017887Transcription factor TCP subgroup
PROSITE profilePS5137011.374218235IPR017888CYC/TB1, R domain
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MHSSTNNNIS CSGILYPFPP YNFPFSSSSS HNNHHPLLPQ ENTTPGGIFG LHQDQFSLVN  60
NSFLPPGPES TMLNLGGDSS NAIVPSPGDY QQHYGYDINN ISHPYFVSKD VQVPVVAVKK  120
DRHSKIFTAQ GFRDRRVRLS LNVAREFFDL QDLLGFDKAS TTLEWLLGKS KNAIRDLEKS  180
KCKNSFSSSS TSECDGVLED NLDKRMRKMK EAAAIMARSS RAKARARARE RTREKMCRIS  240
KRSPQICSHL RLFNELQPAD MNQEPGSTVL TEYHESVALK RKLKAPSGSN YPDRSLELNP  300
QRMEASSNCC SHINIQFPSV ISPNWDINGG VFTCPSICAI TANMNLNSSG F
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011467828.11e-170PREDICTED: transcription factor CYCLOIDEA
TrEMBLA0A2P6SE011e-156A0A2P6SE01_ROSCH; Putative transcription factor TCP family
STRINGXP_004306027.11e-160(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17383294
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G67260.29e-26TCP family protein