PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00002774.1.g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family WOX
Protein Properties Length: 208aa    MW: 24364.1 Da    PI: 9.9557
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00002774.1.g00001.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox711.4e-2285144357
                                     --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
                        Homeobox   3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                                     +R+++t+eql++Leel+++ +r+psae++++++++l    +++ ++V++WFqN++a+e++
  FANhyb_rscf00002774.1.g00001.1  85 SRWNPTPEQLRALEELYRRgTRTPSAEQIQQITAQLrrfgKIEGKNVFYWFQNHKARERQ 144
                                     7*****************99**************************************97 PP

2Wus_type_Homeobox1161.7e-3784146365
               Wus_type_Homeobox   3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                                     ++RW+PtpeQ++ Leely++G+rtP++e+iq+ita+L+++Gkie+kNVfyWFQN+kaRerqk+
  FANhyb_rscf00002774.1.g00001.1  84 SSRWNPTPEQLRALEELYRRGTRTPSAEQIQQITAQLRRFGKIEGKNVFYWFQNHKARERQKR 146
                                     79***********************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003899.5E-582149IPR001356Homeobox domain
SuperFamilySSF466895.26E-1385151IPR009057Homeodomain-like
PfamPF000462.7E-2085144IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.4E-985144IPR009057Homeodomain-like
CDDcd000862.84E-686146No hitNo description
PROSITE profilePS5007111.45190145IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048513Biological Processanimal organ development
GO:0099402Biological Processplant organ development
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 208 aa     Download sequence    Send to blast
MWMMGYNDSS DFNIIPDSAF NGRKIRPLVP RTHNNNNNNS STSTHAPPCF SRIHAASDFL  60
AQYHQLGEQR GMREFNTVPQ VVVSSRWNPT PEQLRALEEL YRRGTRTPSA EQIQQITAQL  120
RRFGKIEGKN VFYWFQNHKA RERQKRRRQM ESHDDLQLMC SADHQKKESL GGTSRTVYEV  180
EETKNWAPST NCMTTSLQDH LHHHQQQR
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011464491.11e-138PREDICTED: WUSCHEL-related homeobox 1
SwissprotQ6X7K01e-52WOX1_ARATH; WUSCHEL-related homeobox 1
TrEMBLA0A2P6P1V71e-131A0A2P6P1V7_ROSCH; Putative transcription factor Homobox-WOX family
STRINGXP_004301251.11e-108(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF28923471
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18010.14e-54WUSCHEL related homeobox 1
Publications ? help Back to Top
  1. Guan C, et al.
    Spatial Auxin Signaling Controls Leaf Flattening in Arabidopsis.
    Curr. Biol., 2017. 27(19): p. 2940-2950.e4
    [PMID:28943086]