PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00002690.1.g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family NAC
Protein Properties Length: 469aa    MW: 53175.7 Da    PI: 7.2821
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00002690.1.g00001.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM159.61.2e-49351602128
                             NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratks 80 
                                     +pGfrFhPt+eel+ +yL++kvegk++++ e i+ +d+y+++Pw+Lp++++ +ekew+f+++rd+ky++g+r+nr+t+s
  FANhyb_rscf00002690.1.g00001.1  35 MPGFRFHPTEEELIEFYLRRKVEGKRFNV-ELITFLDLYRYDPWELPAMAAIGEKEWFFYVPRDRKYRNGDRPNRVTTS 112
                                     79***************************.89***************888889************************** PP

                             NAM  81 gyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                     gyWkatg d+ + s++ + +glkktLvfy+g+apkg +t+W+m+eyrl
  FANhyb_rscf00002690.1.g00001.1 113 GYWKATGADRMIRSENFRSIGLKKTLVFYSGKAPKGIRTSWIMNEYRL 160
                                     **********************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100555.55234181IPR003441NAC domain
SuperFamilySSF1019411.96E-5534181IPR003441NAC domain
PfamPF023652.2E-2436160IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 469 aa     Download sequence    Send to blast
MAIAATRMSH EEDESNKQHH EVEVDHDEHE HDMVMPGFRF HPTEEELIEF YLRRKVEGKR  60
FNVELITFLD LYRYDPWELP AMAAIGEKEW FFYVPRDRKY RNGDRPNRVT TSGYWKATGA  120
DRMIRSENFR SIGLKKTLVF YSGKAPKGIR TSWIMNEYRL PHHETERYQK GEISLCRVYK  180
RPGVEDHPSL PRSLPSSRAA AANANGASTS RSLLQAQSSS SSSLNKKQHS INSSLMEKLQ  240
ANFNFNGGSS SLGQSVQQLH HHHHQDQVAA DPKINETEGS SGNSDVTSTL GVGLRSSATN  300
IPIHHPSSPL GLQPHHHHHG GVLHLDDHHA EQEGISTFLQ QHHHHSKPQT LLFAGSSVSA  360
TSNVIDDLQR LLNYQQQQAV SNIANQQQAL HVQQYYDAHS HNHNHNQQLP SNVVNHFSSP  420
FPLVPPPPSQ SQLSPNGLQV TAFSDRLWDW NPISEPNRAP DQYNTNPFK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-543618119165NO APICAL MERISTEM PROTEIN
1ut4_B1e-543618119165NO APICAL MERISTEM PROTEIN
1ut7_A1e-543618119165NO APICAL MERISTEM PROTEIN
1ut7_B1e-543618119165NO APICAL MERISTEM PROTEIN
3swm_A1e-543618122168NAC domain-containing protein 19
3swm_B1e-543618122168NAC domain-containing protein 19
3swm_C1e-543618122168NAC domain-containing protein 19
3swm_D1e-543618122168NAC domain-containing protein 19
3swp_A1e-543618122168NAC domain-containing protein 19
3swp_B1e-543618122168NAC domain-containing protein 19
3swp_C1e-543618122168NAC domain-containing protein 19
3swp_D1e-543618122168NAC domain-containing protein 19
4dul_A1e-543618119165NAC domain-containing protein 19
4dul_B1e-543618119165NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00257DAPTransfer from AT2G02450Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004301581.10.0PREDICTED: NAC domain-containing protein 48
TrEMBLA0A2P6PCA80.0A0A2P6PCA8_ROSCH; Putative transcription factor NAM family
STRINGXP_004301581.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF72033146
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.11e-107NAC domain containing protein 35