PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00002219.1.g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family WOX
Protein Properties Length: 233aa    MW: 26612.7 Da    PI: 9.5714
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00002219.1.g00001.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.71.1e-19142202257
                                     T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
                        Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                                     r+R+t++++qle+Le+ +++ n +p +++ +e++k+l    ++te++V++WFqNrRa+ k+
  FANhyb_rscf00002219.1.g00001.1 142 RQRWTPSNTQLEILERIYNEaNGTPGKHRVKEITKELsqhgQVTETNVYNWFQNRRARSKR 202
                                     89*****************99**************************************97 PP

2Wus_type_Homeobox93.22.3e-30141204265
               Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                                     ar+RWtP+++Q++iLe++y+++  tP k+++++it+eL+++G+++++NV++WFQNr+aR+++kq
  FANhyb_rscf00002219.1.g00001.1 141 ARQRWTPSNTQLEILERIYNEANGTPGKHRVKEITKELSQHGQVTETNVYNWFQNRRARSKRKQ 204
                                     789***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007114.366138203IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.7E-16138205IPR009057Homeodomain-like
SMARTSM003892.3E-11140207IPR001356Homeobox domain
SuperFamilySSF466891.5E-17140205IPR009057Homeodomain-like
CDDcd000861.79E-12142204No hitNo description
PfamPF000462.8E-17142202IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
MEGQRKVLAV KERLRTQNPD GFCVMTDDQV EQLQKQIAVY AVICEQLVDM HKAFTAQQDL  60
AGSSLNLQFS ITLPFIMQKL YDTTSLGPCF FRAILFYSLH LLTMKFLLNI LPISISLSGP  120
GMKMGNVYGD LMPFGGNKVT ARQRWTPSNT QLEILERIYN EANGTPGKHR VKEITKELSQ  180
HGQVTETNVY NWFQNRRARS KRKQSVPTRN ITESDIEPEV ISPKDKKTKP EDM
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1195203RRARSKRKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004300539.12e-76PREDICTED: WUSCHEL-related homeobox 8-like
TrEMBLA0A2P6PBJ96e-69A0A2P6PBJ9_ROSCH; Putative transcription factor Homobox-WOX family
STRINGXP_004300839.12e-94(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18553493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35550.17e-35WUSCHEL related homeobox 13