PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00002170.1.g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family NAC
Protein Properties Length: 371aa    MW: 42312 Da    PI: 9.6523
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00002170.1.g00001.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM161.14.1e-50131411128
                             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratk 79 
                                     lppGfrFhP+deel+v+yL++kv++++l++ + i+e+d+yk++Pw+Lpk++  +e+ewyfFs+r++ky++g+r+nra++
  FANhyb_rscf00002170.1.g00001.1  13 LPPGFRFHPSDEELIVHYLQRKVTSRPLPA-HLITEIDLYKYNPWELPKMALFGEDEWYFFSPRERKYPNGERPNRAAA 90 
                                     79****************************.88***************77777999*********************** PP

                             NAM  80 sgyWkatgkdkevlsk..kgelvglkktLvfykgrapkgektdWvmheyrl 128
                                     sgyWka g+dk++l++   ++ +g+kk Lvfy+grap+g+kt+W+m eyrl
  FANhyb_rscf00002170.1.g00001.1  91 SGYWKAAGSDKPILTTcgISKRIGVKKALVFYTGRAPTGSKTEWIMIEYRL 141
                                     ***************9766677***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.27E-559146IPR003441NAC domain
PROSITE profilePS5100552.90513175IPR003441NAC domain
PfamPF023653.8E-2614141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    Send to blast
MEPAFSASPN FQLPPGFRFH PSDEELIVHY LQRKVTSRPL PAHLITEIDL YKYNPWELPK  60
MALFGEDEWY FFSPRERKYP NGERPNRAAA SGYWKAAGSD KPILTTCGIS KRIGVKKALV  120
FYTGRAPTGS KTEWIMIEYR LLDSSIKPSR SKGSMKKWKG LEGEKVLMLG LLTYSKEIDV  180
NSRPYRAVLK GHIASRNTSK NKCNSQGSSP EYWSGLQKVE QTQYTYANPN IEMITDFLYK  240
DCTLLASILA GQAPPISSVR FQRTNNGYEA GPNYKVNSTI SISSPGLISE TLKRKTTEEI  300
TKKNSFRIDN NLASKSNNED LLPRKRMEEN YIRSYNHSHS QNDIVKANPI DTTDYEELNE  360
MAILGRYFSE I
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-601015614153NO APICAL MERISTEM PROTEIN
1ut4_B4e-601015614153NO APICAL MERISTEM PROTEIN
1ut7_A4e-601015614153NO APICAL MERISTEM PROTEIN
1ut7_B4e-601015614153NO APICAL MERISTEM PROTEIN
4dul_A4e-601015614153NAC domain-containing protein 19
4dul_B4e-601015614153NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011461700.10.0PREDICTED: NAC domain-containing protein 2-like
TrEMBLA0A314YIC51e-129A0A314YIC5_PRUYE; NAC domain-containing protein 2
STRINGXP_009338296.11e-127(Pyrus x bretschneideri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF24162981
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77450.17e-66NAC domain containing protein 32