PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00001772.1.g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family GATA
Protein Properties Length: 326aa    MW: 35320.4 Da    PI: 8.2559
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00001772.1.g00001.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA59.93.3e-19238272135
                            GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                                     Cs+Cg+ kTp+WR gp+g ktLCnaCG++y++ +l
  FANhyb_rscf00001772.1.g00001.1 238 CSHCGVQKTPQWRTGPNGAKTLCNACGVRYKSGRL 272
                                     *******************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011412.426232268IPR000679Zinc finger, GATA-type
SMARTSM004015.5E-17232286IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.33E-14233294No hitNo description
Gene3DG3DSA:3.30.50.102.6E-15236270IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.83E-14237285No hitNo description
PfamPF003203.4E-17238272IPR000679Zinc finger, GATA-type
PROSITE patternPS003440238263IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MECVALKTSI RTEMAVKEAV FDDLWGLNAQ NGGVQNCEDF SVDDLLDFSN DDGFVEQEEQ  60
EDDKIDSVLP KKESTVEEKE NSTPSSCVSE KNELGPEPAE PTSGRLGKSR VVVSFRGGLV  120
LGVQRLSPRR VYGRETREKT RTGGPQAMFQ DSGSGQGQKQ AYPDRRPGLV TRVTLFTETS  180
SSSSSSSSTS SCPSSPWLIY NPTQGPGGFG SSVEKPQKKP KRPATTEGGG SSQPPRRCSH  240
CGVQKTPQWR TGPNGAKTLC NACGVRYKSG RLVPEYRPAC SPTFSSELHS NHHRKVMEIR  300
RKKEVPGGPE PGLMTTAAAT LVVCSF
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004287842.26e-85PREDICTED: GATA transcription factor 5-like
TrEMBLD9ZIZ12e-76D9ZIZ1_MALDO; GATA domain class transcription factor
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.21e-45GATA transcription factor 5